KEGG   Monodelphis domestica (opossum): 100025270Help
Entry
100025270         CDS       T01031                                 

Gene name
NCOA1
Definition
nuclear receptor coactivator 1
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Thyroid hormone signaling pathway
Class
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:mdo04919]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1326 aa AA seqDB search
MSGLGDSSTDPSNPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANIGDIDSL
SVKPDKCKILKKTVDQIQQMKRMEQEKTATDDDVQKSDISSSSQGMIEKESLGPLLLEAL
DGFFFVVNREGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIRPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEEGEDFQ
SCLICIARRLPRPAAITGSESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTAFSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHNVLSPQDNTNSGMSLPRINPSVNPSVSPAQSLARSSTLPPSSNNMVTPRVNH
QQSPDLHSNSSNTNSNNSQGSFGCSAGNQVVASIALNQGQAGSQGSNHSLSLNNSPMDST
GITLAQFMSPRRQVNSGLVTRPRMPNNSFSPNISSLSNPIGMVGSACGNPNRTYSNISAA
SLQGINEGPSNSIGFSATSPVLRQLSSQNSPSRMNMLPTKAESKESKEITSILNEMVQSD
NSSNDVKPLDSGLLHSTDKLSEGDNKYSQTSHKLVQLLATTAEQQLRHTDADTSGKDSLS
CSGTSTATSINSSSSGNTCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEHEKKDNGSG
SVNNQVPGNANIKLELEASKKKESKDHQLLRYLLDKDEKDLRAAPTLSLDDVKVKVEKKE
QMDPCNTTPTTLTKPTPEEIKLETQNQFPADLDQFDPLLPTLEKASQLPGLCESERMEGG
GTGVAIKSEILPTALQSTPVRPPPRLNRLPELELSGLDHQFGQPTIDDQVPWTNNTMTAM
NQGPLNKPEDISVNSSLSFDSLCPIVVLFNLKVLNYSSQPYTADTGAEYHLWLIHQNRQA
ILNQFAASAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRALLM
RQQSFGNSLPPSSGLPVQMGTSRLPQGAPQQFPYPSSYGTNPGTPPTSTSPFSQLASNPE
ASLASRNNMVNRGITGNVGGQFGTGINPQMQQSVFQYPGSGLGQQSEPNFTPSLSPGSPM
MSLQIPPSQSPMLQQTQTQPTSGYQSPDMKTWQQGAMGNNNMFSQTQPAPAQPGVYNNMS
ITVSMAGGNTNVQNMNPMMGQMQMSSLQMPGMNTVCSEQINDPALRHTGLYCNQLSSADI
LKTESDSGAQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGSQKPTSGPQNPQAQQKSLL
QQLLTE
NT seq 3981 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccttggagacagttcaacagacccttctaaccctgactcacacaagagaaaa
gggtcaccatgtgacacactggcatcaagcactgaaaagaggcgcagggaacaagaaaat
aaatatttagaagagctggctgaattgctgtctgcaaacattggtgatattgatagcctg
agtgtaaaaccagacaaatgcaagattttgaagaaaacagtcgatcagattcagcaaatg
aaaagaatggaacaagagaaaacagcaactgatgatgacgtccagaaatcagacatctca
tcaagtagtcaaggaatgattgaaaaagaatctttgggaccccttcttttggaggccttg
gatggatttttctttgttgtgaatcgtgaagggagaattgtttttgtgtcagagaatgtg
accagctatttaggttacaatcaggaggaactgatgaataccagtgtctacagcatcctt
catgtgggagatcatgcagaatttgtcaagaatctgctaccaaaatcactagtaaatgga
gttccttggcctcaggaggcaacaagacgaaatagccatacctttaactgccggatgcta
attcgccctccagatgagccaggcacagagaaccaagaagcttgccagcgatatgaagta
atgcaatgtttcactgtgtcacagccaaaatcaatccaggaagaaggagaagatttccaa
tcatgtttgatttgtattgcacgccgattgcctcgacctgcagctattacgggttcagaa
tcttttatgaccaagcaagatactacaggtaaaatcatctctattgacaccagttccttg
agagctgctggtagaaccggctgggaagatttagtaaggaagtgcatttatgcctttttc
cagcctcaaggcagagagccatcttatgccagacagctgtttcaagaagtgatgactcgt
ggcactgccttcagcccatcctataggttcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgcaaactttgctaccctcaaagtccagacatgcagcctttcatcatggga
attcatatcatcgacagggaacacaatgttctttctcctcaagacaacactaattctgga
atgtcacttcctcgaataaacccttcagtaaatcctagtgtctctcctgcccagagtttg
gcccgatcatctactcttccaccatctagcaacaatatggtgacccctagagtaaaccat
caacaaagtcctgaccttcatagcaacagcagtaatactaattccaacaacagccaaggg
agctttggatgttcagctggaaatcaagtggtagccagtattgccttaaaccagggacag
gctggttcccagggcagtaatcactctttaagcctcaacaattctccaatggatagtaca
ggaattaccttagcacagttcatgtctccaagaagacaagttaactctggattggtaaca
agaccaagaatgcctaacaattctttttctcccaatatttcttcactcagtaatcctatt
ggcatggtaggcagtgcctgtggtaatcctaataggacttattcaaacatctcagcagct
tctttacagggtattaatgaaggacccagtaactccattggcttttctgctacatcgcct
gttctcagacagctgagctcacaaaattctcctagtagaatgaatatgctgccaacaaaa
gcagaatccaaagaaagcaaagaaatcacatccattttgaatgaaatggttcaatctgac
aatagttcaaatgatgttaaaccattggattcaggcctcttgcatagtactgacaaactc
tcagagggagataataaatactctcaaaccagtcataaactagtacagcttttggcaaca
actgctgaacagcagttacggcatacagatgctgatacaagtggcaaagattctttatct
tgctcaggcacctcaactgcaacatctattaactcttcatcttcaggcaacacttgcccc
tcctctcatagttcattgactgagagacacaaaattctacacaggcttttgcaagaaggt
agtccctcggatataactactctatcagtggaacatgagaaaaaggataatggatctggt
tctgtgaataatcaagtgccaggaaacgccaacataaaattagaactggaggcttcaaag
aaaaaggaatcaaaggaccatcaattattgcggtaccttttagataaagatgagaaagac
ttaagagcggctccaaccttgagtctggatgatgtgaaagtgaaagttgaaaagaaagag
caaatggatccttgtaatacaactccaacaacgctgactaaacctactccagaggaaatc
aaattagagacccagaatcagtttccagctgaccttgaccagtttgatccattattgcca
acactggagaaggcatcccagctgccaggcttatgcgagtcagaaagaatggaaggtgga
ggcactggggtggccatcaaatcagagatcctgccaactgcccttcagtccaccccagtt
agacctccccccaggctgaatagattacctgagctcgaattgagtggcctagatcatcag
tttgggcaaccaacaatagatgaccaggtcccatggacaaacaacacgatgactgctatg
aatcaaggacctctgaataaacctgaagatatttcagtgaatagctctctttcttttgat
tcactgtgccccattgtggtacttttcaacttaaaagttctgaattactcatcccaaccc
tatactgctgacactggagccgagtaccacttgtggttgatacatcaaaatcggcaggct
atcttaaaccagtttgcagcgtctgcccccgttggcattaatatgaggtcaggcatgcaa
caacagatcacgccacagcctcccctgaatgcccagatgttggcacagcgacagagagaa
ctatacagtcaacagcatcggcaaaggcagctaatacaacagcagagagctctgttaatg
agacagcaaagctttgggaacagcctccccccctcatctggtctcccagttcaaatgggg
acttctcgtcttcctcagggtgctccacagcaattcccttacccttctagttatggtaca
aacccaggaacccctcccacctccactagcccattttcacaactggcatcaaatcctgag
gcatccttggctagccgaaacaatatggtcaacagaggtataacagggaatgttggagga
cagtttggtactggaatcaatcctcagatgcagcagagtgtctttcagtatccaggatca
ggattaggtcaacaaagtgaacccaattttactccgtctctgagccctggcagtcccatg
atgtcactgcagattcctccttcccaaagccctatgctgcaacaaactcaaactcagccc
acttcaggctaccagtcaccagacatgaagacctggcaacaaggagcaatgggcaataac
aacatgttcagtcagacccaacctgcacctgcacagcctggagtatacaacaacatgagc
atcaccgtatccatggcaggaggaaacacaaatgtccagaacatgaaccctatgatgggc
cagatgcagatgagttcattgcagatgccaggaatgaatacagtgtgttctgagcagata
aatgatccagcactgagacacacaggcctttactgcaatcagctttcatcagctgacatt
ctcaaaacagaatcagacagcggtgcccagcaggtgcagcaggttcaggtgttcgccgac
gtccagtgtacagtgaatctggtaggcggggacccttacctgaaccagcctgggcccctg
ggatctcaaaaacccacatcaggtccgcagaacccccaggcccagcagaagagcctcctt
cagcagctactgactgaataa

DBGET integrated database retrieval system