KEGG   Monodelphis domestica (opossum): 100025270Help
Entry
100025270         CDS       T01031                                 

Gene name
NCOA1
Definition
nuclear receptor coactivator 1
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100025270 (NCOA1)
Enzymes [BR:mdo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100025270 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1336 aa AA seqDB search
MSGLGDSSTDPSNPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANIGDIDSL
SVKPDKCKILKKTVDQIQQMKRMEQEKTATDDDVQKSDISSSSQGMIEKESLGPLLLEAL
DGFFFVVNREGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIRPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEEGEDFQ
SCLICIARRLPRPAAITGSESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTAFSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHNVLSPQDNTNSGMSLPRINPSVNPSVSPAQSLARSSTLPPSSNNMVTPRVNH
QQSPDLHSNSSNTNSNNSQGSFGCSAGNQVVASIALNQGQAGSQGSNHSLSLNNSPMDST
GITLAQFMSPRRQVNSGLVTRPRMPNNSFSPNISSLSNPIGMVGSACGNPNRTYSNISAA
SLQGINEGPSNSIGFSATSPVLRQLSSQNSPSRMNMLPTKAESKESKEITSILNEMVQSD
NSSNDVKPLDSGLLHSTDKLSEGDNKYSQTSHKLVQLLATTAEQQLRHTDADTSGKDSLS
CSGTSTATSINSSSSGNTCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEHEKKDNGSG
SVNNQVPGNANIKLELEASKKKESKDHQLLRYLLDKDEKDLRAAPTLSLDDVKVKVEKKE
QMDPCNTTPTTLTKPTPEEIKLETQNQFPADLDQFDPLLPTLEKASQLPGLCESERMEGG
GTGVAIKSEILPTALQSTPVRPPPRLNRLPELELSGLDHQFGQPTIDDQVPWTNNTMTAM
NQGPLNKPEDISVNSSLSFDSLCPIVVLFNLKVLNYSSQPYTADTGAEYHLWLFHFLPVF
LQLIHQNRQAILNQFAASAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQ
LIQQQRALLMRQQSFGNSLPPSSGLPVQMGTSRLPQGAPQQFPYPSSYGTNPGTPPTSTS
PFSQLASNPEASLASRNNMVNRGITGNVGGQFGTGINPQMQQSVFQYPGSGLGQQSEPNF
TPSLSPGSPMMSLQIPPSQSPMLQQTQTQPTSGYQSPDMKTWQQGAMGNNNMFSQTQPAP
AQPGVYNNMSITVSMAGGNTNVQNMNPMMGQMQMSSLQMPGMNTVCSEQINDPALRHTGL
YCNQLSSADILKTESDSGAQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGSQKPTSGPQ
NPQAQQKSLLQQLLTE
NT seq 4011 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccttggagacagttcaacagacccttctaaccctgactcacacaagagaaaa
gggtcaccatgtgacacactggcatcaagcactgaaaagaggcgcagggaacaagaaaat
aaatatttagaagagctggctgaattgctgtctgcaaacattggtgatattgatagcctg
agtgtaaaaccagacaaatgcaagattttgaagaaaacagtcgatcagattcagcaaatg
aaaagaatggaacaagagaaaacagcaactgatgatgacgtccagaaatcagacatctca
tcaagtagtcaaggaatgattgaaaaagaatctttgggaccccttcttttggaggccttg
gatggatttttctttgttgtgaatcgtgaagggagaattgtttttgtgtcagagaatgtg
accagctatttaggttacaatcaggaggaactgatgaataccagtgtctacagcatcctt
catgtgggagatcatgcagaatttgtcaagaatctgctaccaaaatcactagtaaatgga
gttccttggcctcaggaggcaacaagacgaaatagccatacctttaactgccggatgcta
attcgccctccagatgagccaggcacagagaaccaagaagcttgccagcgatatgaagta
atgcaatgtttcactgtgtcacagccaaaatcaatccaggaagaaggagaagatttccaa
tcatgtttgatttgtattgcacgccgattgcctcgacctgcagctattacgggttcagaa
tcttttatgaccaagcaagatactacaggtaaaatcatctctattgacaccagttccttg
agagctgctggtagaaccggctgggaagatttagtaaggaagtgcatttatgcctttttc
cagcctcaaggcagagagccatcttatgccagacagctgtttcaagaagtgatgactcgt
ggcactgccttcagcccatcctataggttcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgcaaactttgctaccctcaaagtccagacatgcagcctttcatcatggga
attcatatcatcgacagggaacacaatgttctttctcctcaagacaacactaattctgga
atgtcacttcctcgaataaacccttcagtaaatcctagtgtctctcctgcccagagtttg
gcccgatcatctactcttccaccatctagcaacaatatggtgacccctagagtaaaccat
caacaaagtcctgaccttcatagcaacagcagtaatactaattccaacaacagccaaggg
agctttggatgttcagctggaaatcaagtggtagccagtattgccttaaaccagggacag
gctggttcccagggcagtaatcactctttaagcctcaacaattctccaatggatagtaca
ggaattaccttagcacagttcatgtctccaagaagacaagttaactctggattggtaaca
agaccaagaatgcctaacaattctttttctcccaatatttcttcactcagtaatcctatt
ggcatggtaggcagtgcctgtggtaatcctaataggacttattcaaacatctcagcagct
tctttacagggtattaatgaaggacccagtaactccattggcttttctgctacatcgcct
gttctcagacagctgagctcacaaaattctcctagtagaatgaatatgctgccaacaaaa
gcagaatccaaagaaagcaaagaaatcacatccattttgaatgaaatggttcaatctgac
aatagttcaaatgatgttaaaccattggattcaggcctcttgcatagtactgacaaactc
tcagagggagataataaatactctcaaaccagtcataaactagtacagcttttggcaaca
actgctgaacagcagttacggcatacagatgctgatacaagtggcaaagattctttatct
tgctcaggcacctcaactgcaacatctattaactcttcatcttcaggcaacacttgcccc
tcctctcatagttcattgactgagagacacaaaattctacacaggcttttgcaagaaggt
agtccctcggatataactactctatcagtggaacatgagaaaaaggataatggatctggt
tctgtgaataatcaagtgccaggaaacgccaacataaaattagaactggaggcttcaaag
aaaaaggaatcaaaggaccatcaattattgcggtaccttttagataaagatgagaaagac
ttaagagcggctccaaccttgagtctggatgatgtgaaagtgaaagttgaaaagaaagag
caaatggatccttgtaatacaactccaacaacgctgactaaacctactccagaggaaatc
aaattagagacccagaatcagtttccagctgaccttgaccagtttgatccattattgcca
acactggagaaggcatcccagctgccaggcttatgcgagtcagaaagaatggaaggtgga
ggcactggggtggccatcaaatcagagatcctgccaactgcccttcagtccaccccagtt
agacctccccccaggctgaatagattacctgagctcgaattgagtggcctagatcatcag
tttgggcaaccaacaatagatgaccaggtcccatggacaaacaacacgatgactgctatg
aatcaaggacctctgaataaacctgaagatatttcagtgaatagctctctttcttttgat
tcactgtgccccattgtggtacttttcaacttaaaagttctgaattactcatcccaaccc
tatactgctgacactggagccgagtaccacttgtggttatttcattttctccctgtcttt
ctccagttgatacatcaaaatcggcaggctatcttaaaccagtttgcagcgtctgccccc
gttggcattaatatgaggtcaggcatgcaacaacagatcacgccacagcctcccctgaat
gcccagatgttggcacagcgacagagagaactatacagtcaacagcatcggcaaaggcag
ctaatacaacagcagagagctctgttaatgagacagcaaagctttgggaacagcctcccc
ccctcatctggtctcccagttcaaatggggacttctcgtcttcctcagggtgctccacag
caattcccttacccttctagttatggtacaaacccaggaacccctcccacctccactagc
ccattttcacaactggcatcaaatcctgaggcatccttggctagccgaaacaatatggtc
aacagaggtataacagggaatgttggaggacagtttggtactggaatcaatcctcagatg
cagcagagtgtctttcagtatccaggatcaggattaggtcaacaaagtgaacccaatttt
actccgtctctgagccctggcagtcccatgatgtcactgcagattcctccttcccaaagc
cctatgctgcaacaaactcaaactcagcccacttcaggctaccagtcaccagacatgaag
acctggcaacaaggagcaatgggcaataacaacatgttcagtcagacccaacctgcacct
gcacagcctggagtatacaacaacatgagcatcaccgtatccatggcaggaggaaacaca
aatgtccagaacatgaaccctatgatgggccagatgcagatgagttcattgcagatgcca
ggaatgaatacagtgtgttctgagcagataaatgatccagcactgagacacacaggcctt
tactgcaatcagctttcatcagctgacattctcaaaacagaatcagacagcggtgcccag
caggtgcagcaggttcaggtgttcgccgacgtccagtgtacagtgaatctggtaggcggg
gacccttacctgaaccagcctgggcccctgggatctcaaaaacccacatcaggtccgcag
aacccccaggcccagcagaagagcctccttcagcagctactgactgaataa

DBGET integrated database retrieval system