KEGG   Monodelphis domestica (opossum): 100025278Help
Entry
100025278         CDS       T01031                                 

Gene name
CDC27
Definition
cell division cycle 27 homolog (S. cerevisiae)
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:mdo04120]
Cellular Processes; Cell growth and death; Cell cycle [PATH:mdo04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:mdo04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:mdo04914]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mdo05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 829 aa AA seqDB search
MEEDLRTLKRSSQAAIWQALNHYAFRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYK
AYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVLNKQKSHDDIVTEFGDSACF
TLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNF
SSCLPNTCTTLVSNHNLYHRQPETVLMETPQDTIELNRLNLESSNSKYSLNTDSSVSYID
SAVISPDTVPLGTGTTILSKQAQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGS
YLQNYTNSSSVIDVPSTGAPSKKSVGRISQAGTKSVFSQSGNSREVTPILVAQTQSSGPQ
TSTTPQVLSPTIAAPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNK
GGITQPNINDSLEITKLDSSIISEGKISTVTPQIQAFTIQKAAAEGLMSLLRDMGKGYLA
LCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEG
LEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQ
VDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAE
MHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIIIDPKNPLCKFHRASVLFA
NEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQI
KEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggatctaaggacactgaaaagaagcagtcaggctgctatatggcaagcacta
aaccactatgctttccgagatgcagttttccttgcagaaagactgtatgccgaagtacac
tcagaagaagcattgtttttactggctacctgttattatcgctcaggaaaggcatataaa
gcatatagactcttgaagggacacagttgtactacaccacagtgtaaatatctacttgca
aaatgttgcgtcgaccttagcaagcttgctgagggggaacagatcttgtctggtggagtt
ttaaataaacagaaaagccatgatgatattgttacggagtttggtgattcagcttgcttc
acactttcattgttgggacatgtatattgcaagacagatcggcttgccaaaggatcagaa
tgttaccaaaagagccttagtttaaatcctttcctctggtccccttttgagtcattatgt
gaaataggtgaaaagccagatcctgaccaaacatttaaattaacatcgttacagaatttt
agcagctgtctgcccaacacttgcacaaccctagtatctaatcacaatttatatcacaga
cagcctgagacagttctaatggaaacaccccaagatacaattgaattaaacagactgaat
ttagaatcctccaattcaaagtactccttgaacacagattcctcagtgtcttatattgat
tcagctgtaatttcaccagacactgtcccccttggaacaggaactaccatactgtctaaa
caggctcaaaataaaccaaaaactgggcggagtttattaggaggaccagctgctcttagc
cctttaaccccaagttttgggatactgccactagaaactccaagtcctggagatggatca
tatctacaaaactataccaactcctcttctgtaattgatgtgccatccacaggagcccct
tcaaagaagtctgttggcagaatcagccaagctggaacaaagtctgtcttctcacagagt
ggaaatagtcgagaggtaactccaatccttgttgcacaaacacaaagttctggcccacag
acaagtacaacacctcaggtattgagccccactattgctgctccacccaatgcactgcct
cgaagaagctcacgactttttactagtgacagctctacaaccaaggaaaatagtaaaaag
ttaaaaatgaagtttccacctaaaattccaaataggaaaacaaaaagcaagactaataaa
ggaggaataactcaaccaaacatcaatgatagcctggaaattacaaaattggattcttcc
atcatttcagaaggaaaaatatccactgtaacaccacagatccaagctttcactattcag
aaagcagcagcagaaggtttgatgagccttcttcgtgatatggggaaaggctacttagct
ttgtgttcctataattgcaaagaagcgataaacattctgagccacctcccgtctcaccac
tataatactggttgggtactatgccagattggaagagcatactttgaactgtctgaatat
atgcaggctgaaagaatattctcagaagtgagacgaattgaaaattaccgagttgaaggc
ctagagatctactcaacaacactttggcatcttcaaaaagatgttgctctttcagttctt
tcaaaggacttaactgacatggataaaaattcaccagaggcctggtgtgctgcaggaaac
tgtttcagtttgcaaagggagcatgatattgcaattaaattcttccagagagctatccaa
gttgatccaaattatgcttatgcctatacactgctggggcatgaatttgtgttaactgaa
gaactagataaagcattagcctgttttagaaatgcaatcagagtcaatcctagacattat
aatgcatggtatgggttgggaatgatttattacaaacaagaaaagttcagccttgcagaa
atgcatttccaaaaagcacttgatatcaaccctcagagttcagttctactttgtcatatt
ggagttgttcaacatgcactgaaaaaatctgaaaaggctttggataccttaaacaaagcc
atcattattgatcccaagaaccctctatgcaaattccacagagcctcggttttatttgca
aatgaaaaatataagtctgctttacaggaacttgaagaattgaaacagattgttcccaaa
gaatctctcgtttacttcttaataggaaaggtttacaagaagctaggtcaaactcatctg
gccctgatgaatttctcttgggcaatggatttagaccctaaaggagctaacaaccagatt
aaagaagcaattgacaagcgttatcttccagatgatgaggaacccataactcaagaagaa
cagatcatgggaacagacgaatcccaagagagcagcatgacagatgcagatgacacacaa
cttcatgcagcagaaagtgatgaattttaa

DBGET integrated database retrieval system