KEGG   Monodelphis domestica (opossum): 100025278Help
Entry
100025278         CDS       T01031                                 

Gene name
CDC27
Definition
cell division cycle protein 27 homolog-like
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100025278 (CDC27)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100025278 (CDC27)
   04114 Oocyte meiosis
    100025278 (CDC27)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100025278 (CDC27)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100025278 (CDC27)
Protein phosphatases and associated proteins [BR:mdo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100025278 (CDC27)
Ubiquitin system [BR:mdo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     100025278 (CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 833 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAFRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVLNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSSCL
PNTCTTLVSNHNLYHRQPETVLMETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTTILSKQAQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQN
YTNSSSVIDVPSTGAPSKKSVGRISQAGTKSVFSQSGNSREVTPILVAQTQSSGPQTSTT
PQVLSPTIAAPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGIT
QPNINDSLEITKLDSSIISEGKISTVTPQIQAFTIQKAAAEGLMSLLRDMGKGYLALCSY
NCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGLEIY
STTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPN
YAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQ
KALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIIIDPKNPLCKFHRASVLFANEKY
KSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAI
DKRYLPDDEEPITQEEQISECYPYESVGTDESQESSMTDADDTQLHAAESDEF
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatatggcaagcactaaaccactatgct
ttccgagatgcagttttccttgcagaaagactgtatgccgaagtacactcagaagaagca
ttgtttttactggctacctgttattatcgctcaggaaaggcatataaagcatatagactc
ttgaagggacacagttgtactacaccacagtgtaaatatctacttgcaaaatgttgcgtc
gaccttagcaagcttgctgagggggaacagatcttgtctggtggagttttaaataaacag
aaaagccatgatgatattgttacggagtttggtgattcagcttgcttcacactttcattg
ttgggacatgtatattgcaagacagatcggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtccccttttgagtcattatgtgaaataggtgaa
aagccagatcctgaccaaacatttaaattaacatcgttacagaattttagcagctgtctg
cccaacacttgcacaaccctagtatctaatcacaatttatatcacagacagcctgagaca
gttctaatggaaacaccccaagatacaattgaattaaacagactgaatttagaatcctcc
aattcaaagtactccttgaacacagattcctcagtgtcttatattgattcagctgtaatt
tcaccagacactgtcccccttggaacaggaactaccatactgtctaaacaggctcaaaat
aaaccaaaaactgggcggagtttattaggaggaccagctgctcttagccctttaacccca
agttttgggatactgccactagaaactccaagtcctggagatggatcatatctacaaaac
tataccaactcctcttctgtaattgatgtgccatccacaggagccccttcaaagaagtct
gttggcagaatcagccaagctggaacaaagtctgtcttctcacagagtggaaatagtcga
gaggtaactccaatccttgttgcacaaacacaaagttctggcccacagacaagtacaaca
cctcaggtattgagccccactattgctgctccacccaatgcactgcctcgaagaagctca
cgactttttactagtgacagctctacaaccaaggaaaatagtaaaaagttaaaaatgaag
tttccacctaaaattccaaataggaaaacaaaaagcaagactaataaaggaggaataact
caaccaaacatcaatgatagcctggaaattacaaaattggattcttccatcatttcagaa
ggaaaaatatccactgtaacaccacagatccaagctttcactattcagaaagcagcagca
gaaggtttgatgagccttcttcgtgatatggggaaaggctacttagctttgtgttcctat
aattgcaaagaagcgataaacattctgagccacctcccgtctcaccactataatactggt
tgggtactatgccagattggaagagcatactttgaactgtctgaatatatgcaggctgaa
agaatattctcagaagtgagacgaattgaaaattaccgagttgaaggcctagagatctac
tcaacaacactttggcatcttcaaaaagatgttgctctttcagttctttcaaaggactta
actgacatggataaaaattcaccagaggcctggtgtgctgcaggaaactgtttcagtttg
caaagggagcatgatattgcaattaaattcttccagagagctatccaagttgatccaaat
tatgcttatgcctatacactgctggggcatgaatttgtgttaactgaagaactagataaa
gcattagcctgttttagaaatgcaatcagagtcaatcctagacattataatgcatggtat
gggttgggaatgatttattacaaacaagaaaagttcagccttgcagaaatgcatttccaa
aaagcacttgatatcaaccctcagagttcagttctactttgtcatattggagttgttcaa
catgcactgaaaaaatctgaaaaggctttggataccttaaacaaagccatcattattgat
cccaagaaccctctatgcaaattccacagagcctcggttttatttgcaaatgaaaaatat
aagtctgctttacaggaacttgaagaattgaaacagattgttcccaaagaatctctcgtt
tacttcttaataggaaaggtttacaagaagctaggtcaaactcatctggccctgatgaat
ttctcttgggcaatggatttagaccctaaaggagctaacaaccagattaaagaagcaatt
gacaagcgttatcttccagatgatgaggaacccataactcaagaagaacagatcagtgag
tgttatccatatgaatcagtgggaacagacgaatcccaagagagcagcatgacagatgca
gatgacacacaacttcatgcagcagaaagtgatgaattttaa

DBGET integrated database retrieval system