KEGG   Monodelphis domestica (opossum): 100025486Help
Entry
100025486         CDS       T01031                                 

Gene name
MAP2K5
Definition
mitogen-activated protein kinase kinase 5
Orthology
K04463  
mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100025486 (MAP2K5)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100025486 (MAP2K5)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    100025486 (MAP2K5)
  Nervous system
   04722 Neurotrophin signaling pathway
    100025486 (MAP2K5)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100025486 (MAP2K5)
Protein kinases [BR:mdo01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100025486 (MAP2K5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 448 aa AA seqDB search
MLWLALGPSHAMENQVLVIRIKIPDGGAVDWTVHSGPQLLFRDVLDVIGQVLPDATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGKRNIHGL
KVNTRAGPSHHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTV
YKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKIPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMKKQPKERPAPEDLMGHPFIM
QYNDGNAEVVSMWVCRMLEERRTQQGPQ
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggctagcccttggtccctctcatgccatggagaaccaggtgctggtgattcga
atcaagatcccagatggtggagctgtggactggacagtgcactctgggccccagttgctt
ttccgggatgtgttggatgtgataggccaggttttacctgatgcaaccactacagcattt
gaatatgaagatgaggatggtgatcggattactgtaagaagtgatgaagaaatgaaggct
atgttgtcatattattattccacagtaatggaacagcaagtaaatggacagttaatagag
cctctgcagatatttccaagagcctgcaagcctcctgggaaacggaacatacatggcctg
aaggtgaatacacgggccgggccctctcatcatagtagcccagcagtttcagattcactt
ccaagcaatagcttaaagaagtcttctgctgaattgaaaaaaatattagccaatggccag
atgaatgaacaagacatacggtatcgagacaccctcggtcatggcaatggaggcacagtc
tacaaagcatatcatgtcccaagtggaaaaatattagctgtaaaggtgatattactagat
attacactggaacttcaaaaacaaattatgtctgaattggaaattctttataagtgtgat
tcgtcatatattataggattttatggtgcattttttgttgaaaacaggatttcaatatgt
acagaattcatggatgggggatctttggatgtgtataggaaaattccagagcatgtactg
ggaagaattgcagtagcagttgttaaaggcctaacttacctgtggagtttaaagatatta
catagagatgtgaaaccctccaatatgttggtgaacacaagaggacaggtcaagctctgt
gattttggagttagcactcagctggtgaattctatagccaagacgtatgttggaacaaat
gcttatatggcgcctgaaagaatttcaggagagcagtatggcatccattctgatgtttgg
agcttaggaatctctttcatggagcttgctcttgggaggtttccatatcctcagattcag
aaaaaccagggatctttaatgcctctccagctactgcagtgcattgttgatgaggattcg
ccagtccttccggttggagagttctccgaaccatttgtacacttcatcactcagtgcatg
aagaagcagccaaaagaaaggccggcacctgaggatctgatgggccacccatttatcatg
caatacaatgatgggaatgctgaagtggtctccatgtgggtgtgcaggatgctggaggag
agacggacccagcagggacctcagtga

DBGET integrated database retrieval system