KEGG   Monodelphis domestica (opossum): 100025548Help
Entry
100025548         CDS       T01031                                 

Gene name
EPHA8
Definition
EPH receptor A8
Orthology
K05109  
Eph receptor A8 [EC:2.7.10.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Axon guidance
Class
Organismal Systems; Development; Axon guidance [PATH:mdo04360]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 996 aa AA seqDB search
MARNSTLGNQMGWLERALVSCFAVNLLDTSTIHGDWGWLTYPAHGWDSINEVDEFFSPIH
TYQVCNVMSPNQNNWLRTNWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKETFNLYYLE
SDRDLGTSTQESQFVKIDTIAADESFTGADLGVRRLKLNTEVRGVGPLSKRGFYLAFQDI
GACIAILSLRVYYKKCPAMVRNLAAFSEAVTGADSSSLVEVRGECVGHSEERDTPKMYCS
AEGEWLVPIGKCVCSAGYEELQDACVACELGTYKSAPGDQLCARCPLHSHAATSAAQTCH
CDVSYYRAALDPPSAACTRPPSAPVNLISSVNGTSVTLEWDPPLDKGGRSDITYNAICRR
CSWDQGHCETCGSGTRFVPQQMNLVQTALTVANLLAHMNYTFWIEAINGVSDLSLEPRRV
ASVNITTNQAAPSQVVAIRQERAGQTSVTLLWQEPAQPNGIILEYEIKYYEKDKEMQSYS
TLKATTTRATVSGLKPGTHYVFQVRARTSAGCGRFSPAMEVETGKPRLRYDTRTIAWICL
TLITGLVILLLLLICKKRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHPPGKIPEPQ
FYSDPHTYEEPGRARRSFSREIEASRIHIEKIIGSGESGEVCYGRLRMPGQREVPVAIKA
LKAGSSERQRRDFLSEASIMGQFDHPNIIHLEGVVTRGRLAMIVTEYMENGSLDSFLRTH
DGQFTIVQLVGMLRGVGAGMRYLSDLGYVHRDLAARNVLVNSQLVCKVSDFGLSRVLEDD
PDAAYTTTGGKIPIRWTAPEAIAFRKFSSASDVWSFGVVMWEVLAYGERPYWNMTNRDVI
SSVEEGYRLPAPMGCPAALHQLMQDCWHKERSQRPRFPQIVSILDSLIRNPETLRVTATV
NRCPPPAFARSCFDLRGGGGGGGVTVGDWLDSIRMGRYREHFAAGGYSSLGMVLRMNAQD
VRGLGITLTGHQKKIVNSIQAMRSQLTSPSGPRRPL
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
atggccagaaatagcactttggggaatcagatggggtggcttgaaagggctcttgtttcc
tgttttgcagtgaacttgctggacacatcgaccatccatggggactggggctggctcaca
tacccggcacatgggtgggattccatcaacgaagtggacgaattcttcagtcccatacac
acataccaagtatgcaacgtcatgagccccaaccagaataactggcttcggacgaactgg
gtaccacgggatggtgcccgcagggtgtatgcggaaatcaagttcaccctgagagattgt
aacagcatgcctggggtgctggggacctgcaaggagaccttcaacctctactacctggaa
tctgaccgggacctgggcaccagcacccaggagagccagttcgtgaaaatcgacaccatt
gcggcggatgagagcttcactggtgcggacctgggtgtccggcgcctcaagctcaacacg
gaggttcggggtgtggggccactgagcaagcgaggcttttacctggccttccaggacatc
ggggcctgcattgccatcctctccctccgggtttactacaagaagtgcccggccatggta
cgcaacctggctgccttctcggaggcagtgacaggggctgactcttcctccctggtggaa
gttcgtggggagtgtgtgggccactcagaggagcgggatacacccaagatgtactgcagt
gctgagggggagtggctggtgcccattgggaagtgcgtgtgtagtgctggttatgaggaa
ctccaagatgcctgcgtggcctgtgaactggggacttataaatcagctccaggagaccag
ctgtgtgccaggtgccccttacacagccatgcagctacatctgcagcccagacctgccac
tgtgatgtcagctattaccgggctgcccttgacccgccatctgcagcctgtactcggcct
ccctctgccccagtgaacctgatctccagtgtgaatgggacctctgtgaccctggagtgg
gaccctcccctggacaagggaggccgcagtgacatcacttacaacgccatctgccgccgc
tgctcctgggaccagggccactgtgagacctgtggcagtggcacccggtttgtgccccag
cagatgaacctggtacagacagccctgacggtagccaacctccttgcccacatgaactac
accttctggatcgaggctatcaatggtgtgtctgacctcagtctggagccccgacgagtt
gcctctgtcaacatcaccacaaaccaggcagccccctcccaagtggtggcgatccgccag
gagcgagctgggcagaccagtgtcacactgctgtggcaagagccagcccagcctaatgga
atcattctggaatatgaaattaaatactatgagaaggacaaggagatgcaaagttactcc
accctcaaggccaccaccaccagggcaactgtctctggcctgaagccaggcacccattat
gtgttccaggtgcgagcccgcacttcagcgggctgtggccgctttagtccggccatggaa
gtggagactggaaaaccaagactccgctatgacaccaggaccatcgcgtggatttgcttg
actctcatcactggtctggtcatcctgctgctgctgctcatctgtaaaaagaggcactgt
ggctacagcaaggccttccaggactctgatgaggagaagatgcactatcagaatgggcag
gctcctcccccagtcttccttcccctgcaccacccccctgggaagattcctgaaccccag
ttctactcagaccctcacacctatgaagaacctgggcgagctcgccgtagcttcagtcgt
gagatcgaggcctccaggatccatattgagaaaatcatcggttctggcgagtccggagag
gtgtgctatggacgattgcggatgccagggcagcgagaggtgccagtggctatcaaggcc
ctgaaggcagggtcctcagagagacagcggagagacttcctcagtgaggcatccatcatg
ggacagtttgaccaccccaatatcattcatcttgagggtgttgtcacccgaggccgcctg
gcaatgattgtgaccgagtacatggagaatggctccctggattcttttctgaggacccat
gacgggcagttcaccatcgtgcagctggtgggcatgctgcgaggggtgggcgctggcatg
cgctacctctctgacctaggctatgtccatcgagacctggctgcccgcaatgtcctggtc
aacagccagctggtgtgcaaggtgtctgactttggcctctctcgtgtcctggaagatgac
cctgatgccgcctataccacgacgggtgggaagatacccatccgctggacagcccctgaa
gccattgctttccgcaagttctcctcagccagtgacgtgtggagttttggggtggtgatg
tgggaggtgctggcctacggggagcggccatactggaacatgacgaaccgagatgtcatt
agctcggtggaggaagggtaccgtctccctgcccccatgggctgtcccgcagccctccac
cagctcatgcaggattgctggcacaaggagcggagccagaggcctcgtttcccccagatc
gtcagcatcctcgactcgctcatccgcaaccccgagactctcagggtcactgccacagtg
aacaggtgcccacccccagcctttgcccgcagttgctttgaccttcgaggcggcggcgga
gggggcggcgtcactgtgggggactggctggactccatcaggatgggtcgataccgggag
cactttgccgcagggggctactcttctctgggcatggtcctgcgcatgaacgcccaggat
gttcgtggcctgggcatcaccctcacaggacaccagaagaagattgtcaacagcatccag
gccatgcggtcccagctgaccagtcccagtggccctcggaggcccctctga

DBGET integrated database retrieval system