KEGG   Monodelphis domestica (opossum): 100025565Help
Entry
100025565         CDS       T01031                                 

Definition
steroid 21-hydroxylase-like
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mdo00140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 465 aa AA seqDB search
MRRTISPYHFPPLVPGFFHLFQADLPSHLQSLAQRYGPLYRVHLGMQDVVVLNSKKAIEE
ALTKNWLDFSGRPQTFTNQEVSKNSHDLSLGDYTPLWKAQRKLARSALLYVQNTMEPIIG
QMVQDLCKRLLAQAGSPVSIHKELSMFTGSIISFLSFGEKRESVIQQFYSCIQELMVVWD
SWQIQILDVLPILRVFPNSGLRKLRRLVKKRDRIVQEQLSRHKETMVEGQIRDLTDYMLQ
KLREQAEGSNRLSEEHVHMALVDIFIGGMETMSSTLTWALAFLLHHPEIQRRLQEELDEE
LDSGSPGSLPNYRDRDRFPLLNATITEVLRLRPAAPLALPHYTRQPSTICGFDIPKNTIV
IPNIYGAHHDDRIWEQPYDFRPDRFLESEPSQAGIPFSCGVRVCLGETMARFELFLILAQ
LLWTFKLLPVEGNASLPSLKPEFGAFMLKAPNFLVRLLPRRQELE
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcggagaactatctcaccttatcatttcccacctctagtccctggcttcttccatctc
tttcaagctgatctcccaagtcatttgcagagccttgcacagaggtatggccccctctat
cgggttcaccttgggatgcaagatgtcgtggtgctaaactccaagaaagcaattgaggag
gccttgactaagaactggctggatttttcagggagaccccaaacattcacaaaccaagag
gtaagcaagaacagccacgacctatctcttggggattacactccactgtggaaggcccaa
aggaagctggcccgttctgctcttctgtatgtccagaatactatggaacccatcataggg
cagatggtacaggacctgtgtaagaggcttcttgcccaggctgggtctcccgtgtccata
cacaaggagctctccatgttcactggtagcatcatcagcttcctcagttttggagaaaag
agagaatctgtaatccagcagttttacagctgcattcaggaattaatggtagtttgggat
tcttggcaaatccagatcttggacgtcctacccatcctcagggttttccccaactcaggt
ctcaggaaactgagacggctggtaaagaaacgggacagaattgtgcaggagcagttgtcg
aggcacaaggagacaatggtggaaggacagattcgggatttgaccgactacatgctacaa
aagctaagggaacaagcagaagggtcaaatcggctgtctgaggaacacgtacacatggcc
ctggtggacatattcatcggcggcatggagaccatgtcgtccaccctcacctgggctctg
gccttcctgttgcaccatccagagatacagaggcggctgcaggaagaactggatgaagag
ctggactcaggctccccgggaagccttcccaactaccgggacagggatcggttccccctg
ctcaatgccaccatcaccgaggtgctccggctgcgcccggcagcccccttggctctgcca
cactacacccggcagcccagcaccatatgcggctttgacatcccgaagaacaccattgtc
atccccaacatctatggggctcaccatgacgacagaatctgggaacaaccttatgatttc
aggcctgatcgtttcttggagtcagaaccgagccaggcagggatcccgttcagctgcggg
gtcagagtgtgcctgggggagaccatggctcgctttgaactcttcctgatactggcccag
ctactctggaccttcaaactgctgcctgtggagggcaatgcctcgttgccctctctgaag
cctgagtttggggccttcatgttaaaggccccaaactttctggtaaggctattgccccgg
cggcaggagttggagtga

DBGET integrated database retrieval system