KEGG   Monodelphis domestica (opossum): 100025642Help
Entry
100025642         CDS       T01031                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 1-1-like
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100025642
   00053 Ascorbate and aldarate metabolism
    100025642
   00500 Starch and sucrose metabolism
    100025642
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100025642
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100025642
   00860 Porphyrin and chlorophyll metabolism
    100025642
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100025642
   00982 Drug metabolism - cytochrome P450
    100025642
   00983 Drug metabolism - other enzymes
    100025642
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100025642
Enzymes [BR:mdo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100025642
Glycosyltransferases [BR:mdo01003]
 Others
  Hydrophobic molecule
   100025642
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
2
AA seq 529 aa AA seqDB search
MAAGLQLERVLLLWACCVLWAEAGRLLVLPQDGSHWLSMRGVLREMHRRGHQVEVVAPAA
TVHIAEAAFYTLTPYPVPFRLVELQARFREMNYGVFEKLSPLENFFKTKERVRNNTALFL
SSCAHLLHNSALMARLADAHFDAVLTDPFLPCGVIVARSLSLPAVYFLQALPCMLDAQST
QCPSPPSYVPRGFSKNTDHMTFLQRVKNMLLSAAEPFLCDFVYGPYARLASEVLGEDVSV
QDLLSYGSVWLLRKDFVKEYPSPVMPNMVFIGGINCADQKPLSGEFEAYVNASGEHGVVV
FSLGSMVSEIPMAKAMEIAEALGTIPQTVLWRYTGKPPSNLAKNTKLVKWLPQNDLLAHP
KARAFITHAGSHGIYEGICNGVPMVLMPLFGDQMDNAKRMESRGAGVILNVLDMTSSDLS
KALKTVINDKSYKENIMRLSALHKDRPIDPLNLAVFWVEFVMRHKGAPHLRAAAHDLNWI
QYHSLDVIAFLLAIVLTVVLIIVKSCKFCFRKCFGKKGKAKKSTKPKSH
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaggactgcagttggagcgtgtcctgctgctctgggcgtgctgcgtgctgtgg
gcagaggcgggcaggctcttggtgctcccccaggatggcagccactggctcagcatgcgc
ggcgtcctgcgggagatgcaccgaaggggccaccaggtggaggtggtcgcccccgcagcg
acggtccacatcgcagaggcagccttctacaccctcacgccctacccggtgcccttccgg
ctggttgagctgcaggcccgcttccgcgagatgaactacggcgtctttgagaaactgtcg
ccgctcgagaacttcttcaagaccaaagagagagtccggaacaacacggccctgttcctg
tcctcctgcgcccacctgctccacaactcggcgctcatggcccggctggccgacgcccac
tttgacgcggtcctcacagaccccttcctgccctgcggcgtcatcgtggccaggtcgctc
tcgcttcccgccgtctactttttacaggcgctgccgtgcatgctggacgcccagagcacg
cagtgccccagcccgccctcctacgtgccccggggcttctcgaagaacaccgaccacatg
acgttcctccagagagtgaaaaacatgctcctgtccgcggccgagcccttcctctgcgac
tttgtgtacggcccctacgcccggctggcctccgaagtgctgggcgaggacgtgagcgtc
caggacctcctgagctacggatccgtctggctgctgaggaaggacttcgtaaaggagtat
cccagccccgtcatgcccaacatggtcttcatcggaggcatcaactgcgccgatcaaaag
cccttgtctggcgaatttgaagcctacgtgaatgcctctggggaacacggagttgtggtc
ttctccctgggctcgatggtctccgaaatcccaatggccaaggccatggaaattgcggaa
gctttgggcacaatacctcagacggtgttatggcgctacaccggaaagccaccctccaat
ctggccaagaacaccaagctggtgaaatggctcccccagaacgacctgctcgcacaccca
aaggccagggcgttcatcacgcatgccggctctcacgggatctatgaagggatctgtaac
ggagtgccaatggtgctgatgcctctgtttggagaccagatggacaacgcgaagcgcatg
gagtccagaggggcaggggtgatcctgaatgtcctggacatgacgtccagcgatctgagc
aaggccctgaagactgttatcaatgataagagctacaaggaaaacatcatgcgactctcg
gctctgcacaaagatcggcccatcgatcccctcaaccttgccgtgttctgggtggagttc
gtgatgagacacaaaggggcgccccatttgcgtgctgctgcccacgacctcaactggatc
cagtaccattccttggacgtcatcgctttcctcctggctatcgtgctgactgtcgtgcta
atcatcgtgaaaagctgcaagttctgtttccggaaatgcttcggcaaaaaaggaaaagcc
aagaaatccaccaaaccgaagtctcattga

DBGET integrated database retrieval system