KEGG   Monodelphis domestica (opossum): 100025819Help
Entry
100025819         CDS       T01031                                 

Gene name
PGAM2
Definition
(RefSeq) phosphoglycerate mutase 2 (muscle)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Glucagon signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100025819 (PGAM2)
   01230 Biosynthesis of amino acids
    100025819 (PGAM2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100025819 (PGAM2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100025819 (PGAM2)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    100025819 (PGAM2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100025819 (PGAM2)
Enzymes [BR:mdo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100025819 (PGAM2)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100025819 (PGAM2)
  Exosomal proteins of melanoma cells
   100025819 (PGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 253 aa AA seqDB search
MPTHRLVIVRHGESTWNQENRFCGWFDAELSDKGREEAQNGAQAIKEAGMEFDICYTSVL
KRAIRTLWTILDGVDQMWVPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFD
IPPPPMDENHPYYTVISKERRYAGLKPGEMPTCESLKDTIARALPFWNEQIAPQIKAGKR
VLIAAHGNSLRGIVKHLEGMSNEAIMELNLPTGIPIVYELDEQLKPTKPMQFLGDEETVR
KAMEAVAAQGKAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcccacccaccggctagtgatcgtacgccacggcgagagcacatggaaccaagagaac
cgtttctgtggctggtttgatgcagagctgagtgacaaggggagggaagaggcccagaat
ggggcccaggctattaaggaagccggcatggagtttgacatctgctacacctctgtgcta
aagcgggccatccgcaccctctggaccatcctggatggtgtggaccagatgtgggtgccc
gtagtgaggacctggcgcctcaacgagcgccactacgggggtctcacaggcctcaacaaa
gccgagactgctgccaagcacggggaagaacaggtcaagatctggagacgctcctttgac
atcccacccccacccatggacgagaatcatccctactacacagtcatcagcaaggagcgg
cgctatgctggcctgaagcctggggagatgcccacctgtgagagcctgaaggataccatt
gccagagctctgcccttctggaatgagcagattgctccccagatcaaggcagggaagagg
gtgctcattgctgcccacggcaacagcttacggggtatcgtcaagcatctagaaggcatg
tcaaatgaggccattatggaactcaacttgcccaccgggatccccatcgtgtatgaactc
gacgagcagctgaagcccacgaagcccatgcagttccttggggatgaggaaacggtccga
aaggccatggaggctgtggctgcccagggcaaggccaagtaa

DBGET integrated database retrieval system