KEGG   Monodelphis domestica (opossum): 100026011Help
Entry
100026011         CDS       T01031                                 

Gene name
PADI4
Definition
peptidyl arginine deiminase, type IV
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 668 aa AA seqDB search
MAQKRLIRVSLDQPTYAVCVLGTETVVDLQGCAPASCKFFEISATSGVVIDIFNCHPVKK
SPSGTSKWLLEPGVEVTLKMKAPSSLLNDEKVKISYFTSKSSSVQALLYLTGVQISLDAD
TCRNGRIKPTKAKIDKRNWTWGPHGQGAILLVNCDKDNPKSSTVDAKMERVTNNKDLKDM
SLMILSTQTPKDFFSRHQLILHVSKFEMYKVRVFQADRKKWPSKYKMVLGPKMPSHVLTV
LDGHQENTFYVEGLAFPDVDFSGIVSFTVTLTDISNLPIPEALLFEDTVVFRVAPWIMTP
NTQAPQEVYVCRSYDNKSFVDSVKALAKTAKCKLTICPEEENLDDIWMQDEMEFGYTQAP
HKIFPVVFDSPRNRGLKDFPIKTILGPDFGYVTREAEEDLVTGLDSFGNLEVSPPVTVGG
KEYPLGRILIGGSSYPRDQSREMLKELQDFLFAQKVQAPVRLFSDWLSIGHVDEFLSFVP
AQDGKGFRLLLASPSTCYKLFEEKEKEGHGDVKMLEGVKKKGNMMIKDVLSDKTLRQHNQ
YVESCIAWNREILKQELGLTEQDIIDIPQLFRLKLKVSRNELKAEALFPDMVNMLVLGKH
LGIPKPFGPIINGQCCLEEKVRALLEPLGLKCTFIDDYFTYHILSGEVHCGTNVQRKPFP
FKWWNMMP
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggcccagaagagactcatccgggtgtctctggatcagcctacctatgctgtgtgtgtg
ctgggcaccgagactgtggtggatctccaaggatgtgccccagccagctgcaagttcttt
gaaatctctgccacatcaggagtggttattgacatcttcaactgccatcctgtcaaaaag
tcaccctcaggcacatccaaatggctactggagcctggagtggaggtgacactgaagatg
aaagccccgagctcccttctgaatgatgaaaaggtcaagatttcttatttcacatccaaa
tcaagttctgtccaggccttgctctacctcactggtgtccaaatctccctggatgctgat
acttgtcgaaatggcagaataaagcctaccaaagcgaagattgacaagagaaactggaca
tggggcccccatggacaaggtgctatcctgcttgtgaactgtgacaaggataaccccaag
tcttctactgtggatgccaaaatggagagggtgactaacaacaaagacctgaaagatatg
tccctcatgattctgagcacacaaactccaaaagatttcttttcccggcaccaattgatt
cttcatgtttccaagtttgagatgtataaagtgagagtttttcaagctgaccgaaagaag
tggccatccaaatataagatggtactggggccaaagatgccatctcatgtcctgacagtg
cttgatggccaccaagagaataccttttatgtggaaggactcgcctttcccgatgttgac
ttctcaggaattgtttccttcactgtcaccctgacggacatttctaatctgcctatccca
gaagctctgcttttcgaggacacagtggtgttccgtgtggctccctggattatgactcca
aatactcaggctccacaagaggtatacgtgtgcaggagttatgataacaagagctttgtg
gactctgtgaaggccttggccaagacggccaaatgcaagctgacgatctgtcctgaagaa
gaaaacttggatgacatatggatgcaggatgaaatggagttcggttacacccaagcccct
cacaaaatatttcccgttgtctttgactcaccccgaaacagaggactgaaagatttccct
atcaaaaccatcctgggtccagattttggttatgtgactcgagaggcagaggaagatttg
gtcaccggtctggactcttttgggaacctggaggtcagccctcctgtcacagttggagga
aaggagtaccctctgggaagaattctcattggtggaagcagctaccccagggatcagagc
agagagatgcttaaagagctccaggacttcctttttgcccagaaggtccaggctcctgtg
agactcttctctgactggttatccattgggcacgtggatgagttcctcagctttgtccca
gcccaggatggcaagggattcaggcttctcttggccagccccagcacctgctacaagcta
tttgaggagaaagagaaagagggacatggagatgtgaagatgcttgagggggttaagaaa
aaaggaaatatgatgataaaggatgttctgtcggacaaaaccttgagacagcacaatcaa
tatgtggagagctgtattgcctggaaccgagagatcctaaaacaggagctgggcctgact
gagcaggacatcatcgacatcccccaacttttccgccttaagttgaaggtctccagaaat
gaactgaaagctgaggctttgttcccagacatggtgaacatgcttgtgctggggaagcac
ctagggatccccaaaccctttggacccatcatcaatggacaatgctgcctggaggagaag
gtgcgggccttgctagagcccctgggcctgaagtgcactttcattgatgactattttacc
tatcatatcctctcaggagaggtgcactgtggcaccaatgtccaaaggaaacccttcccc
tttaaatggtggaatatgatgccctga

DBGET integrated database retrieval system