KEGG   Monodelphis domestica (opossum): 100026013Help
Entry
100026013         CDS       T01031                                 

Gene name
ART3
Definition
ADP-ribosyltransferase 3
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100026013 (ART3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 373 aa AA seqDB search
MKMNYLEMVPMMLAAVILMEIFQVKGDMLSMSPNTFDDQYLKCARRMETKFVPKLLIEEK
SNHKHFDSVWTGGAYHWELKKSQLLLPPGFLDNHGTALMIYTSHAQRQTPFYREFNSAVE
RAGLSRDEYIYNFHFKALHFYLTRALQLLSRDCEESYRHVAYAKSHFTLSGPHGHNGIRF
SHFTSWNDKPEPLTGSEVLFTVYTCFGVSTKMFSDSVNGSILIPLNEVFKLTQEGNKTNF
IFRSMNKTCSHFDCAYLGGLKTENCVDSTGQLKSRHTYFPEVKSKENEDKTTDQKNHEPH
DPEEMYEGQEPFEELGPRNTDYFDNPAPALIPFPSINPTPASASASVGEMHHPLVGRFIL
LISAFILTLFAHL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaactaccttgaaatggtccctatgatgttggcagctgtgattctgatggaa
atttttcaggttaagggtgatatgttaagcatgtctcccaacacttttgatgaccagtac
ctgaagtgtgctagaagaatggagaccaaatttgttcccaagctgctcattgaggaaaaa
agcaaccataagcacttcgattcggtgtggacaggaggagcctaccattgggaattaaag
aagtcacagctgttgctccccccaggctttctggataaccatggcacggcactcatgata
tatacttcacatgctcaaaggcaaactcccttttaccgagagttcaactctgccgtagaa
agagctggcctgtctcgagatgaatatatctacaacttccacttcaaagctttacacttt
tatctcacaagagccttgcagcttctgagcagagactgtgaggagagttacagacatgta
gcctatgccaaaagccattttactttgtctgggcctcatggacataatggtatcaggttt
tctcattttacctcttggaatgacaaacctgaacctttaactggctccgaagtcttgttc
actgtctacacatgttttggtgtttctaccaaaatgttttctgattcagtaaatggaagc
atcttaatacctctgaatgaggtttttaaactgacccaagaagggaataaaaccaacttt
atctttagaagcatgaacaagacctgcagccatttcgactgtgcatatcttggaggcttg
aaaacagaaaattgtgttgacagcactggacagcttaagtccagacacacctatttccct
gaagtgaaatccaaagaaaatgaagacaagaccactgaccaaaaaaatcatgagcctcat
gatcctgaagaaatgtatgaaggacaagagccttttgaagaacttggtccaagaaataca
gactattttgacaatcctgctccagctctaattccatttcccagcatcaaccccactcca
gcctccgcctctgcttccgttggtgagatgcatcatcccctggttggaaggtttattctt
ttgatcagtgcttttattttaacgctttttgctcatctctga

  All links  
No link information was found.   
DBGET integrated database retrieval system