KEGG   Monodelphis domestica (opossum): 100026017Help
Entry
100026017         CDS       T01031                                 

Gene name
GUK1
Definition
guanylate kinase 1
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100026017 (GUK1)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     100026017 (GUK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 228 aa AA seqDB search
MSWWRVWPKLAATGASATVSASATGAWATGMTGPRPVVLSGPSGAGKSTLLKKLFQEFGN
IFGFSVSHTTRNPRPGEENGKDYHFVTREEMQRDIDAGEFIEHAEFSGNMYGTSKAAVQA
VQAMNRICVLDIDLQGVRNIKKTELQPIYISIQAPSLDILEKRLRDRKTETEESLQKRLT
AAAADMESSKEPNLFDLIIINDDLDEAYLMLRKVLAEEIKKAQQPNDL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgagttggtggcgtgtctggcctaaattggcagccacaggcgcatcagccacagtctcc
gcctccgccacaggagcctgggcgacagggatgacaggaccaaggccagttgtccttagt
ggaccatcaggtgctggaaaaagcaccttgttgaaaaaactttttcaagaatttggcaac
atttttggcttcagtgtctcccataccacgaggaaccctaggcctggagaagaaaatggc
aaagattatcactttgtgaccagggaggagatgcagagagacattgatgctggcgaattc
attgagcatgctgaattctctggaaacatgtacgggacaagcaaagccgctgtgcaggct
gtgcaggcgatgaaccggatctgtgtgttggacatagacctgcaaggagtgagaaacatc
aagaagacggagctacagcccatctatatctccatccaggcgccatccctggacattttg
gaaaagcgactgagagacaggaagaccgaaacagaggagagcctgcagaagaggctgact
gcagccgccgctgacatggagagcagcaaggagcctaacctgtttgatttgatcatcatc
aatgacgacttggatgaggcttatctgatgctgaggaaggtcctagccgaggaaatcaag
aaggcccagcagcccaatgatttatga

  All links  
No link information was found.   
DBGET integrated database retrieval system