KEGG   Monodelphis domestica (opossum): 100026017Help
Entry
100026017         CDS       T01031                                 

Definition
guanylate kinase-like
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mdo00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 198 aa AA seqDB search
MTGPRPVVLSGPSGAGKSTLLKKLFQEFGNIFGFSVSHTTRNPRPGEENGKDYHFVTREE
MQRDIDAGEFIEHAEFSGNMYGTSKAAVQAVQAMNRICVLDIDLQGVRNIKKTELQPIYI
SIQAPSLDILEKRLRDRKTETEESLQKRLTAAAADMESSKEPNLFDLIIINDDLDEAYLM
LRKVLAEEIKKAQQPNDL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacaggaccaaggccagttgtccttagtggaccatcaggtgctggaaaaagcaccttg
ttgaaaaaactttttcaagaatttggcaacatttttggcttcagtgtctcccataccacg
aggaaccctaggcctggagaagaaaatggcaaagattatcactttgtgaccagggaggag
atgcagagagacattgatgctggcgaattcattgagcatgctgaattctctggaaacatg
tacgggacaagcaaagccgctgtgcaggctgtgcaggcgatgaaccggatctgtgtgttg
gacatagacctgcaaggagtgagaaacatcaagaagacggagctacagcccatctatatc
tccatccaggcgccatccctggacattttggaaaagcgactgagagacaggaagaccgaa
acagaggagagcctgcagaagaggctgactgcagccgccgctgacatggagagcagcaag
gagcctaacctgtttgatttgatcatcatcaatgacgacttggatgaggcttatctgatg
ctgaggaaggtcctagccgaggaaatcaagaaggcccagcagcccaatgatttatga

DBGET integrated database retrieval system