KEGG   Monodelphis domestica (opossum): 100026061Help
Entry
100026061         CDS       T01031                                 

Gene name
CAD
Definition
carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase
Orthology
K11540  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase / dihydroorotase [EC:6.3.5.5 2.1.3.2 3.5.2.3]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mdo00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mdo00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 2220 aa AA seqDB search
MAALVLEDGSVLRGQSFGAAVCAAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLVGNY
GIPPDEEDEFNLSQWFESSGIHVAGLVVGECCSTPSHWSATRTLHQWLEEHGIPGLQGVD
TRELTKKLREQGSLLGKLVQDGIEPSSLPFLDPNARALVPEVSIKEPRIYNARGSPRILA
LDCGLKYSQIRCLCQRGAEVTVVPWDYKLDSHEYEGLFLSNGPGDPASCPNVVSMLSNVL
SEPDPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLKGSGRCFLTSQNHGFAVE
TESLPPGWTPLFTNANDLSNEGIVHETLPFFSVQFHPEHRAGPSDMELLFDIFLETVKEN
RAGGKTVRERLMERLCPSGTPTPRDMPPSPRKVLILGSGGLSIGQAGEFDYSGSQAIKAL
KEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQTALN
CGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQA
AAERLGYPVLVRAAFALGGLGSGFASSREELSSLVAPAFAHTSQVLVDKSLKGWKEIEYE
VVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRQTAIKVTQHLGIVG
ECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGISLPDLRNSVT
GGTAAFEPSLDYCVVKVPRWDLSKFLRVSTRIGSCMKSVGEVMAIGRGFEEAFQKALRMV
DENCVGFDHTMKPVSDMELETPTDKRIFVVAAALWAGYTIDRLYELTRIDRWFLQCMKRI
IEHTRKLEEHRGQPLPPDLLHQAKRLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQI
DTVAAEWPAQTNYLYLTYGGTTHDLAFHAPHVLVLGSGVYRIGSSVEFDWCAVGCIRQLR
KMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNM
AMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCHTVGY
PCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVACD
GMVVAVAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQL
IAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRIIMGEEVEPVGLMAGTGVVGVKV
PQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPKKNILLTIGSYK
NKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVEGECPPQRSILEQ
LAENHFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEALGQI
GPAPPLKVHVDCMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGVTMVCAM
PNTRPPIIDAPALALAQKLAETGARCDYALFLGASSENAGTLGAVAGAAAGLKLYLNETF
SELQLESISHWMEHFETWPHHLPIVAHAERQTVAAILMVAQLAQRPVHICHVARKEEILL
IKAAKARGVSVTCEVAPHHLFLSQADLERLGPGKGEVRPELGTLEDVEALWENMAIIDCF
ASDHAPHTLEEKSGSKPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQKLHHNPRRIFHLP
QQEDTYVEVDLEHEWIIPSHMPFSKAHWTPFEGQRVKGTIRRVVLRGEVAYIDGQVLVPP
GYGQDVRKWPQGPVPQHLPSAPPSESIKTPERPRRGLPGHPDGRFHLPPRIHRASDPGLP
AEEPKEKPSRKTVEPDLAGTPDSCCYPPPVPRQASPQNLGTPSLLHTQTSPLLHSLVGQH
ILSVRQFTKDQMSHLFNVAHTLRMMVQKERSIDILKGKVMASMFYEVSTRTSSSFAAAMA
RLGGSVLNFSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGAVELAAKHCRRPVINA
GDGVGEHPTQALLDVFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVA
PPSLRMPPDVLSFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSTQEYEACFGQF
ILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYMRMALLATVLGRY
NT seq 6663 nt NT seq  +upstreamnt  +downstreamnt
atggcggccctggtgttagaggatgggtcggtcctgcggggccagtctttcggcgcggcc
gtatgcgccgccggggaagtagtgttccagactggcatggtgggctaccccgaggccctc
accgatccctcctacaaagcccagatcttggtcctgacgtatccgctcgtgggcaactat
ggcatccccccagatgaggaagacgagttcaacctcagccagtggtttgagtcatcaggg
attcatgtggcaggacttgtggtgggagaatgctgctctacacctagccactggagcgcc
acccgaaccttgcaccagtggctggaggagcatggtatacctggtctccaaggagttgat
actagggaactgacaaagaagttgcgggaacaaggatcacttctgggaaagctggtgcag
gatgggatagagccttcatccctaccatttttggatcccaatgctcgagctcttgtacct
gaggtttccattaaggaaccaaggatatacaatgcaagggggtctccacgaattcttgct
ttggattgtgggctcaaatacagtcagattagatgcttgtgccagcgtggggctgaggtc
actgtggtgccctgggactacaaattagacagccatgagtatgaaggtctgttcctaagt
aatggccctggagaccctgcttcttgccctaatgtggtatctatgctgagcaatgtcctt
tctgagccagacccccgacctgtctttggtatctgcctgggtcaccagctattggcctta
gccatcggagccaagacttacaaaatgaggtatggcaaccgtggccacaaccagccatgc
ctgctaaagggctctggacggtgtttcttaacatctcagaatcatggctttgcagtggaa
acagaatctctgccaccaggctggacccctcttttcacaaatgccaatgatctttccaat
gaaggcattgtacatgagaccctgcccttcttcagcgtccagttccaccctgagcaccga
gccggcccctctgatatggagttgctttttgacatcttcctggagaccgtgaaggagaac
agggctgggggcaagacagttcgtgaaaggttaatggagcgtctctgtccctcgggtacc
cctaccccaagagacatgcctccatctccccgaaaagtgctgatcctgggctcagggggt
ctctccattggccaggctggagagtttgactactctggctctcaggcaatcaaggcccta
aaggaggaaaatattcaaacgctgctgataaatcctaatattgccacagtgcaaacctcc
cagggactggcggacaaagtctatttcttgcctataactcctcattatgtgactcaggtt
attcgtaatgagcgtccagatggtgtattactgacatttgggggccagacagcactgaat
tgtggtgtggagctgactaaggctggggttctggcccggtatggagtacgggtcctaggc
acccccgtagagacaattgagctgactgaggatcggcgtgcttttgcagcaaggatggca
gaaattggagaacatgtggccccgagcgaggctgcaaactccctggaacaggcgcaagct
gctgcagaacgactggggtacccggtcctggtacgtgctgcctttgccctaggtggcctt
ggctccggctttgcttctagcagagaagaactctcctctctggtggccccagcctttgct
cacactagtcaagtactggtggacaagtccctcaagggatggaaagaaatagaatatgaa
gtggtgagagatgcctatggcaactgtgtcacggtatgtaacatggaaaatctagatcca
ctgggcattcacactggtgaatctatagttgtggccccaagccagacactaaacgacagg
gaatatcagctgttgcgacagactgctatcaaggtgactcaacacctgggcattgttggg
gagtgcaatgtacaatatgccttgaaccctgagtctgaacagtactatatcattgaagtg
aatgcacgactgtctcggagttcggcccttgccagtaaagccactggttatcctctggcc
tatgtagcagccaagctggctttgggtatctccttgcctgatctcaggaactcggtaact
gggggtactgctgcttttgagcccagcctggattactgcgtggttaaggtccctcgctgg
gaccttagcaagttcctccgagttagcacaaggattggaagctgcatgaagagtgttggt
gaggtcatggctattggacgtgggttcgaagaggcattccaaaaggccttgcgcatggtg
gatgagaactgtgttggctttgatcacacaatgaagcccgtcagtgacatggagctggaa
acgccaacagacaagcggatctttgtggtagcagctgctttgtgggcaggatataccata
gaccgactgtatgagcttactcgcattgatcgctggttcctgcagtgcatgaaacgcatt
atagagcacactcgaaaactagaggaacaccgtgggcagcccttgccccctgatttgctg
caccaggccaagcgccttggattctccgacaagcagattgccctcgcagtactcagcaca
gagctggccgtacgaaaactacggcaggagctgggcatctgtccagcggtcaagcagatt
gatacagtggcagcagagtggccagctcaaaccaactatctgtacctgacttatggtggc
accacccatgacctggctttccacgctccccatgtcctggtcttgggctctggcgtttac
cgcattggctccagtgtggaatttgactggtgtgctgtgggctgcatccggcagctgcgc
aagatggggtataagactattatggtgaactataaccctgagacagtcagtactgattat
gacatgtgtgatcggctctactttgatgagatctcttttgaggtggtgatggatatctat
gagctagaaaaccctgagggtgtaatcctctccatgggaggtcagttgcccaacaacatg
gcaatggccctgcataggcagcagtgccgagtccttggcacatccccagaagccatcgac
tctgctgagaacagattcaaattttcccgacttcttgacaccattggcatcagtcagcct
cagtggcgagaactcagtgacttggagtctgctcgccagttctgtcacaccgtggggtac
ccttgtgttgtccgcccatcctatgtgctgagtggtgcagctatgaatgtggcctatact
gatggagaccttgagcgatttctgagcagtgcagctgctgtctccaaagaacatcctgtg
gtcatctccaagttcatccaagaggccaaggaaattgacgtggatgctgtggcttgtgat
ggcatggtggttgctgtagctatctcagagcatgtggagaatgcaggggtgcactcaggg
gatgccactttggtgactcctcctcaagacatcacacctaagacattggaaaggatcaaa
gcaattgttcacgctgtgggtcaagagctacaggtcacagggcctttcaatcttcagctc
attgccaaggatgaccagctcaaggttatcgagtgcaatgtccgtgtctctcggtccttc
ccctttgtctctaagacacttggagtagatctggtagccctggctacccgaattatcatg
ggtgaggaggtggagcctgttgggctcatggctggaactggagtagtgggagttaaggtg
ccccagttctcattctcacgcctggcaggagcagatgtggtgctgggtgtagagatgacc
agcactggggaagtggctggctttggggagagccgctgtgaggcctacctcaaggctatg
ctaagcactggcttcaagatccccaagaagaatatcctgctgactattggtagttacaag
aacaagagtgagctgctccctacagtgaggctgttggagagtctaggctatagcttatat
gccagtttgggcacagcagacttctacacagagcatggtgtcaaggttacagccgtggac
tggcactttgaggaggcagttgaaggtgaatgtcctccacaacgaagcatcctggaacag
ttggcagaaaaccactttgaactggtcatcaacctgtcaatgcgaggggcagggggtcga
cgcctctcctcctttgtaaccaaggggtaccggacccgtcgcctggctgcagacttctct
gtgccactcatcattgacatcaagtgcactaagctatttgtagaggcattgggccagatt
gggccagcccctcccctgaaggtgcatgttgactgtatgacctcacagaagcttgtgcgt
ctgccagggctgattgatgtacatgtgcacctacgggaaccaggtggtactcacaaggag
gactttgcctcaggcacagcggctgccctagctggtggggtcaccatggtgtgtgctatg
cccaacactcgacctcccatcatagatgccccagcccttgcccttgcacagaagttggca
gaaacgggggcccgctgtgactatgccttgttccttggggcctcgtcagagaatgcagga
accctgggtgcagtggctggggcagctgcaggattgaagctctatctcaatgagacattc
tctgaacttcaactggagagcatctctcattggatggagcactttgagacatggccacac
catctccccattgtggctcatgcagaacgacagaccgtagctgccatccttatggtagcc
cagttggctcagcgacctgtccacatctgccacgtggcccggaaggaggagatcctatta
attaaagctgcaaaggcacggggggtatcagtgacctgcgaggtggccccccaccatctc
ttcctcagccaagcagaccttgagcgcctggggcctgggaaaggtgaagtccggcctgag
ctcggcacccttgaggacgtggaggctctctgggagaacatggccatcattgattgcttt
gcctcagaccatgctcctcacaccctggaagaaaaatctgggtccaagcctccccctggc
ttcccaggtctggagacaatgcttccattgctgctaacagcggtgagcgagggccgactc
agcctagatgacctgctgcagaagctgcaccacaatccccgacggatctttcacttgccc
cagcaggaggacacctatgttgaggtggatctggagcatgaatggatcatccccagccac
atgcccttctccaaggcacattggacaccttttgagggacagcgagtgaagggcacaata
cggcgagttgtccttcgaggggaggttgcctacattgatggtcaggtactagtgccccct
ggctacgggcaagatgtgaggaagtggcctcaaggcccagtgcctcagcacctgccttca
gccccacccagtgaaagtatcaagactccagaaagaccccgacgtggcctcccaggccat
cctgatgggcgattccatctcccacctcgaatccaccgagcttctgaccctggccttcca
gctgaagaacctaaggagaaaccctcccgcaagacagtggagccagatctcgcaggaact
cctgatagctgctgctaccctcctccagtgcctaggcaggcctcaccccagaacttgggt
actcctagcctgttgcatactcagacttcacccttgctgcattctctagttggccagcat
atactgtctgttcgtcagtttaccaaagatcagatgtcccacctgttcaatgtggcacac
accctgcggatgatggtccagaaggaacggagcatagacattctcaagggcaaggtgatg
gcctccatgttttatgaagtgagcactcgtaccagcagttcctttgcagcagctatggcc
cggctcggaggctctgtgctcaacttctctgaagctacatcgtctgtccagaagggagaa
tccctagcagattctgtccagaccatgagctgctatgccgatgttgttgtgctccggcac
ccccaacctggagctgtggagctggcagccaagcactgccggaggccagtgatcaatgct
ggggatggagtaggagagcacccaacccaggccttgctggatgtctttaccattcgagag
gagctaggaactgtcaatggcatgacgatcaccatggtaggagatctcaagcacggacgg
acagtacactcccttgcctgcctgctcacacagtatcgggtcagtcttcgctatgtggca
ccccccagcctgcgcatgccaccagatgtcttgtcttttgtagcttccagagggactaag
caggaggaatttgagagcattgaggaggccctacctgacacagatgtcctttatatgact
cggattcaaaaggaacggtttggatccacccaagagtatgaagcttgctttggccaattc
atcctcacaccccacatcatgacccgggccaagaagaagatggtcgtgatgcacccaatg
cctcgggtcaacgagatcagtgtggaggtagactctgacccccgagctgcctacttccgg
caggctgagaacggcatgtacatgcggatggccctcctcgctactgtactgggtcgctac
tag

DBGET integrated database retrieval system