KEGG   Monodelphis domestica (opossum): 100026103Help
Entry
100026103         CDS       T01031                                 

Gene name
RPTOR
Definition
regulatory associated protein of MTOR, complex 1
Orthology
K07204  
regulatory associated protein of mTOR
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100026103 (RPTOR)
   04152 AMPK signaling pathway
    100026103 (RPTOR)
   04150 mTOR signaling pathway
    100026103 (RPTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100026103 (RPTOR)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100026103 (RPTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1306 aa AA seqDB search
MESEMLQSPLLGLGEEDESDLTDWNLPLTFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPSHPLAQMPLPPSMKNC
IQLAACEANELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYNTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLYSLLSDPIPEVRCAAVFALGTFVGNSTERTDHSTTIDHNVAMMLAQLINDGSPMVR
KELVVALSHLVVQYESNFCTVALQFIEEEKNYPLPSPAATEGGSLTPVRDGPCTPRLRSV
SSYGNIRAVTTARSLNKSLQNLSLTEESGGSVAFSPGNLSTSSSASSTLGSPENEEYILS
FETIDKMRRVSSYSSLNSLIALRTEFLETSQATVNARPQRILDTSSLTQSAPASPTNKGM
HIHQVGGSPPTSSTSSSSLTNDVTKQPGSRDIPSGRPANVGTMGVQYTPHSHQFPRTRKM
FDKGPDQTTDDADDTVGHKSFISATMQTGFCDWSAKYFAQPVMKIPEEHDLESQIRKERE
WRFLRNTRVRKQAQQIIQKGITRLDDQIFLNRNPGVPSVVKFHPFTPCIAVADKDSICFW
DWEKGEKLDYFHNGNPRYTRVTAMEYLNGQDCSLLLTATDDGAIRVWKNFADVEKNPEMV
TAWQGLSDMLPTTRGAGMVVDWEQETGLLMTSGDVRIIRIWDTDREMKVQDIPTGADSCV
TSLSCDSHRSLIVAGLGDGSIRVYDRRMALSECRVMTYREHTAWVVKAHLQKHPEGHIMS
VSVNGDVRFFDPRMPESLNVLQIVKGLTALDIHPQANLFACGSMNQFTAIYNGNGELINN
IKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRIR
NT seq 3921 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgagatgctgcagtctcctcttctcgggcttggggaggaggacgagtccgac
ctgaccgattggaatttgcctttgactttcatgaagaaaagacactgtgagaagatcgaa
ggctccaaatccttggcccagagttggaggatgaaggaccggatgaagacggttagcgtt
gccttagttttgtgcctaaatgtaggtgtggatcctccggatgtggtgaagacaactccc
tgtgcccgtttagagtgctggattgatcctctgtcaatgggtcctcaaaaagctttggaa
accattggtgcaaatttacaaaagcaatatgaaaattggcagccaagggcccgctacaaa
caaagtcttgatccaacagttgatgaagtcaagaagctttgtacatccctgcgccgaaat
gccaaggaagaacgggttcttttccactacaatgggcatggtgtaccgaggcccacggtg
aatggagaaatctgggtcttcaacaagaactacactcagtatattccactgtccatatat
gatctgcagacttggatgggaagcccttccattttcgtctatgattgctcaaatgctggc
cttatcgtcaagtccttcaaacaatttgcactacagagggagcaagagttagaggtagct
gcaattaacccaagtcatccacttgcccagatgcctttgcccccatcaatgaaaaactgc
attcagctagcagcatgtgaagcgaatgaactcctacctatgatccctgaccttccagct
gaccttttcacatcatgccttacaacacctatcaaaattgcgctcagatggttttgcatg
cagaagtgtgtcagtctggtgcctggagtcacattggatttgatagagaagattcctggc
agacttaatgacaggaggactcctttgggagaactgaattggatcttcacagcaatcaca
gataccattgcttggaatgtgctgcccagggatctcttccaaaagcttttcagacaggat
ctcttggtggcaagtctatttcgtaactttctattggcagaaaggatcatgagatcatat
aactgtaccccagtcagcagtccacgcctacctcctacctatatgcatgcaatgtggcaa
gcttgggacctagcagttgatatttgcctctcccaattgccaaccattatagaggaagga
actgcatttaggcacagcccattctttgctgagcaattgacagcattccaggtgtggctc
acaatgggtgttgagaataggaatccaccagaacaacttcccatagtcttgcaggtgctg
ttaagccaagttcatcggttgagagctctcgacttactgggaaggtttttagacttgggc
ccctgggcagtgagcctggctttgtcagttggcatcttcccttatgtactaaaactgctt
cagagttcagccagagagctgagaccacttcttgttttcatatgggctaaaattctagct
gtggacagttcatgccaagctgatctcgtgaaggacaacggtcacaaatatttcctctct
gtcttagcagacccttacatgccagctgagcatagaaccatgacagctttcattctggct
gtgattgtcaacagctataacacaggacaggaagcctgtcttcaaggcaacctgattgcc
atttgtctagagcaactgaatgacccacaccctctgctacgccaatgggtagccatctgc
ttgggacggatttggcagaattttgattcagcaaggtggtgtggtgtaagagacagtgcc
catgagaaactctacagtcttctctctgatccaattcctgaggttcgttgtgctgcagtc
tttgccctcggcacttttgtgggtaactctacagagaggactgatcactctaccaccatt
gatcacaatgtggctatgatgttggctcagcttatcaatgatggaagccctatggttagg
aaggaactggtggtagctctgagtcatcttgtggttcaatatgagagcaatttctgcaca
gtagccttgcaattcattgaagaagaaaagaactaccctttgccttctccggctgccaca
gagggaggcagtttgacacctgtgcgagatggtccatgtacacctagacttcgctcagtc
agctcctatggaaatattagagcagttactacagcaagaagtttgaacaagtctttgcag
aatctgagcttgacagaagaatctggaggttctgttgcattttccccaggcaatctcagc
actagtagtagtgcaagcagcaccttgggcagccctgaaaacgaagagtacatcctttca
tttgagacaattgataagatgagaagagtcagctcttattcctctctgaactcactcata
gcacttaggacagagtttttagaaactagccaggcaactgtcaatgcccgtccccagcgc
atccttgacacatcttcccttactcagtctgctcctgctagtccgaccaacaaaggcatg
cacattcaccaagttggaggctctcctccaacatcaagtaccagcagctccagcctgacc
aatgatgtgactaagcagccaggcagtcgggacatcccatcaggcagaccagctaatgtg
ggcaccatgggtgtgcagtatacacctcactcccaccagttccccaggactcgtaaaatg
tttgataaaggcccagaccagaccactgatgatgctgatgacactgttgggcacaaaagt
ttcatttcggccacaatgcagacaggattctgtgactggagcgccaagtattttgcccaa
ccagtaatgaagatcccagaagaacatgacttagaaagccaaatccgaaaagagcgggaa
tggagatttctacgaaacacacgtgtgagaaagcaagcacagcagatcatccagaagggt
ataacaagactagatgatcaaatcttccttaataggaaccctggtgttccctcagtggtc
aaattccatcccttcaccccatgcatagctgtagctgataaagacagcatttgtttttgg
gactgggaaaagggggagaagttggactacttccacaatggaaatcctcgctacaccaga
gtcactgccatggaatatctgaatggccaggattgttcattgctgttgacagccacagat
gatggtgccatcagggtgtggaagaattttgcagatgtggaaaagaaccctgagatggtg
actgcctggcagggactttcagacatgctaccaacaacaagaggagcagggatggtggtg
gactgggaacaagagactggtcttctcatgacctcaggagatgtgcgaattatccgaatc
tgggacacagatagagagatgaaagtgcaggatatacccacgggtgcagacagctgtgtg
acaagcctctcctgcgactctcaccgttcactcattgtggctggacttggtgatggttcc
attcgggtctatgatagaagaatggcactcagtgaatgccgagttatgacctaccgtgag
cacactgcctgggtggtgaaagcacacctccagaaacatcccgagggccacattatgagt
gtcagcgtaaatggagatgtacgtttcttcgacccccgaatgcctgagtctttaaatgtc
ctccaaatagtgaaaggactaacggccctcgacattcatccacaagcaaatttgtttgca
tgtggttcaatgaatcagttcactgcaatctacaatgggaatggagagctgattaacaac
atcaaatactatgatgggtttatgggccaaagagtcggagccatcagctgtttggctttt
cacccacactggcctcatttggcggttggaagcaatgactactacatctccgtgtactcc
gtggagaagcgcatcagataa

DBGET integrated database retrieval system