KEGG   Monodelphis domestica (opossum): 100026361Help
Entry
100026361         CDS       T01031                                 

Gene name
MAPK6
Definition
mitogen-activated protein kinase 6
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100026361 (MAPK6)
Protein kinases [BR:mdo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100026361 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 722 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAVKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANLLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIKNDMTEPHKPLTQLLPGISREALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDC
QFSDHDWPIHNNFDIEEVQRDPRALSDVTDEEEVQVDPRKYLDGDREKYLKDPAFDTHFS
TEPCWQYPDHHENKYCDLECSHTCNYKMRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCERNGLVKAQIALEEASQQLVEKEREKNQGFDFDSFIAGTIQLSSQ
HESTDVVDKLNDLNSSVSQLELKSLISKSVSREKQEKGMANLAQLEALYQSSWDSQFVSG
GEECFLIDQFCCEVRKDEQIEKENTYTSYLDKFFSRKEDTEMLETEPIEDGKFGERESEE
GFLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSSILKH
LN
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaagtttgaaagtctcatgaacattcatggttttgatctgggctctcggtat
atggacttaaaaccgctgggttgtggtggcaatggcttagttttttctgctgtcgataat
gactgtgacaaaagagtggctgtcaagaaaattgttcttacagatccccagagtgttaaa
catgctttacgcgaaatcaaaattattagaagactcgaccatgataacattgtgaaagta
tttgaaattcttggtcccagtggaagccagttaacagatgatgtgggctctctgacagaa
ctgaacagtgtttacattgttcaggagtacatggagacagacttggctaatctgctagag
cagggccctttattggaggagcatgccaggcttttcatgtatcagctgctacgtgggctc
aagtatattcattctgcaaatgtactgcacagagatctcaaaccagctaatcttttcatt
aataccgaagacttggtgctgaagataggtgactttggtcttgcccggatcatggatccc
cattattcccacaagggtcatctttctgaaggattggttactaaatggtacagatctcca
cgacttttactttctcctaataactatactaaagccattgatatgtgggctgcaggatgc
atctttgctgaaatgctgactgggaaaaccctctttgcaggtgcacatgaacttgaacag
atgcaactgattttagaatctattcctgttgtacatgaggaagatcgtcaggagcttctc
agtgtaatcccagtttacataaaaaatgatatgactgagccacacaaacccttaactcag
ctgcttccaggaattagtcgtgaagcactggacttcctggaacaaattttgacatttagt
cccatggatcgattgaccgcagaagaagctctgtcccatccttatatgagcatttattcc
tttccaatggatgaaccaatttcaagccatccttttcacattgaagatgaagttgatgat
attttgctcatggatgaaactcatagtcatatttataattgggagaggtaccatgattgt
cagttttcagaccatgactggcctatacataataattttgatattgaagaagttcagcgt
gacccaagggctctttctgatgtcactgatgaagaggaagtccaagtagatcctcgaaaa
tatttggatggagatcgtgaaaagtatctgaaggatcctgcctttgatacccatttctct
actgagccttgttggcaatatccagatcatcatgaaaacaagtattgtgatctggaatgc
agccacacttgtaactacaaaatgaggtcgtcatcatatctagataacttagtttggaga
gagagtgaagttaaccattactatgaacccaaacttattatagatctttctaattggaaa
gaacaaagcaaagaaaaatctgataagaaaggcaagtcaaaatgtgaaaggaatggattg
gttaaagctcaaatagctcttgaggaagcatcacagcaactggttgaaaaagaaagggag
aagaatcaaggatttgactttgattcctttattgcaggaactattcaacttagttcacaa
catgagtctactgatgttgttgataaattaaatgacttgaatagctcagtgtcccaacta
gaattgaaaagtttgatatcaaagtcagtaagccgggaaaaacaggaaaaaggaatggcg
aatttggctcagttagaagctttgtaccagtcttcttgggacagccagtttgtgagtggt
ggggaggaatgttttctcatagatcagttttgttgtgaagtaagaaaggatgaacagatt
gagaaggaaaacacttacaccagttacttggacaagttctttagcaggaaggaagatact
gaaatgctagaaactgagccaatagaggatggcaagtttggggaaagagaaagtgaggag
ggttttcttaacaatagtggggagttcctctttaacaagcagcttgagtctataggcatc
ccacagtttcatagtccagttggttcaccacttaaatcaatacaggctacattaacacct
tctgctatgaaatcttccccccagattccccataaaacatacagcagcattctgaaacat
ctgaactaa

DBGET integrated database retrieval system