KEGG   Monodelphis domestica (opossum): 100026585Help
Entry
100026585         CDS       T01031                                 

Gene name
USP36
Definition
ubiquitin specific peptidase 36
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100026585 (USP36)
Peptidases [BR:mdo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100026585 (USP36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1141 aa AA seqDB search
MPIVDKLKEALKPGRKDSTDDGDLGKLLASSAKKVLLQKIEFEPASKSFSYQLESLKSKY
VLLNPKTESAGRHKSCDEAHIRRQGSDHGFESCSDGVPAPQKVLFPVERLSLKWERIYRV
GAGLHNLGNTCFLNSTIQCLTYTPPLANYLLSKEHTRNCHQGGFCMLCVMQNHMIQAFAN
SGNAIKPVSFIRDLKKIARHFRFGNQEDAHEFLRYIIDAMQKACLNGYTKLDRQTQATTL
VHQIFGGYLRSRVKCSVCKSVSDTYDPYLDVALEIRQAANIVRALELFVKPDVLSGENAY
MCAKCKKKVPASKRFTIHRTSNVLTLSLKRFANFSGGKITKDVGYPEFLNIRPYMSQSNG
DPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLVHSSNIKVVLNQQAYVLFY
LRIPGSKKSPEGPIAKTASALPTRTNNVVPEHIKKNISNGIVPSPLIGKKLDLVSVKKLQ
TAEENGVPVSRNSFVVGLKSQNGSVQLKLPLGSLSPKLCSKPIHGPIILDKLGKKVKKPL
SLQHLSPSLKMSQGLNGISNLSSTKLESRRQSSWESKNAVLATSPKLLPEVTINGHGPKS
NGECSDPKRKDSISSSPEYSSSGETARGPETSKSGVGCFYTSQETDYSAGERAKEPPGGE
DSKMVKLKSPVLTNTATEPTSIMSPPPAKKLALSSKKASTLRRATANDLHSPPHSSFADH
TYPTKITHPVFTSSWPVSKIRAVSPLKSSNTMKSAFNSYSIKASPLPSSLRPSGMTEPHS
CSFASNPLPQVNGDFVSPSHQQQGTSSAPYSFSKKRRKKHIGEDRPIRSLEEEISQRNGK
AADLSHIKKKKKRKHRSWIEVAASLIQEEQTQSCNSEIGTKLCLDVAVNGLEEESENQEM
NDSHKGDMTDAHYLSKKKEKKRKRMEECNEEHCHYQKSSLDSSCSIWDKEEPESITETPR
KKKKKKRKQDSEQEGEENEHQKHQRKDCQNDPKVIPKENTFCKDSNQSQALNGQHPGNVA
PYMFLEKKQAPLQLWNREKESNVVQELLKYSSDKAYGKKVLTWDGEMSAISQDAIQYSRL
AQNETVIDDWDKEFDFGKEKKTKKFKREKRRNFNAFQKLQSRRNFWSVTHPAKVTSLSYR
R
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
atgccaattgttgataagctaaaggaagctctgaaacctggtcggaaggattcaacagat
gatggtgatctggggaagctcttggcttcttctgccaaaaaagtcctcctacagaagata
gaatttgagcctgcgagcaagagcttctcttaccaattagagtccttaaagagcaaatat
gtactgttgaaccccaaaacagaaagtgctggtcgccataagagttgtgatgaggcacac
atcaggagacagggcagtgatcatgggtttgaaagctgtagtgacggtgttcctgcccca
cagaaagttctcttccctgtggaacgactatctttgaagtgggagcgcatttaccgagtt
ggagcaggtctccataacttaggcaacacctgcttcttgaactccaccatacagtgtttg
acctacacaccccctctagccaactacttgctctctaaggaacatactcggaattgtcac
caaggaggtttttgtatgctgtgtgttatgcagaatcacatgatccaggcctttgccaat
agtggcaatgctatcaagccagtctcctttatccgagacctgaaaaaaattgctaggcac
ttccgctttggaaaccaggaagatgcacatgaatttcttcggtacattattgatgctatg
caaaaggcctgcttgaatggctatacaaaattagatcgccagacacaggcaactacttta
gtccatcagatttttggaggttacctcagatctcgggttaagtgctcagtatgtaaaagc
gtctctgacacctacgatccctatttggatgttgcactggagatcaggcaagctgcaaat
attgtgcgtgccttggagctgtttgtaaaaccagatgttttgagcggagagaatgcttac
atgtgtgctaaatgcaagaaaaaagtaccagccagtaagcgcttcacaattcataggaca
tccaatgtcttaactctctctctgaagcgctttgcaaacttcagtgggggtaagattacc
aaggatgtgggatatccagaatttcttaatatacgtccatatatgtcccaaagtaatggt
gaccctgttatgtatggattatatgctgtacttgtccattcaggttatagctgccatgct
ggacattattactgttatgtcaaggctagcaatgggcagtggtatcagatgaatgattct
ttggtccattctagtaatatcaaagtggtcctgaatcagcaagcctatgttctgttctat
ctcagaattccaggctctaagaagagtcctgagggccccattgcaaaaactgcctctgcc
cttcctactcgaacaaacaatgtagttccagaacacatcaagaaaaatattagtaatggt
attgttccctcaccactaattggaaagaaattggacttggtatcggtgaaaaaattgcaa
acagcagaagaaaatggtgtcccagtttccagaaatagctttgtagtaggccttaaatca
caaaatggaagtgttcaactaaagctgcccttggggtccctgtccccaaaactttgttca
aagcctatccatggacccatcatactggataaactgggaaaaaaggttaagaagcctctc
tccctgcaacacctttctccctcactaaaaatgtctcaggggttaaatggcatcagcaac
ttaagcagcacaaaacttgagagtcgtaggcaaagctcatgggagagcaagaatgctgta
ctagctacctcacctaagctcctgcctgaagtgactatcaatggccatgggccaaagagt
aatggtgagtgttcagatcccaagaggaaggattccatcagctccagccctgaatactct
tccagtggtgagacagccagggggcccgagacctcgaagagtggagttggctgtttctat
acttctcaggaaacagactattctgctggtgagcgtgccaaagagccacctggtggagag
gattctaagatggtgaagttaaagtcccctgtcctgaccaatactgccactgagcctaca
agcatcatgtcccccccaccagccaaaaaactggccctttcttccaagaaggccagcacc
ctacggagggcgaccgccaatgacctccattcacctccccattcatcatttgctgaccac
acctaccccacgaaaatcacccaccctgtcttcacttcttcttggcctgtcagtaaaatc
agggctgtttcacctctcaaatcatcaaatactatgaagtctgccttcaactcctactca
atcaaagcttcaccactaccctccagcctcaggccttcaggaatgactgaaccacatagc
tgctcctttgcttccaatcccctgcctcaggtaaatggggactttgtgtccccttcacac
cagcagcaggggaccagcagtgccccttacagcttctccaaaaagagaaggaaaaagcat
ataggagaagacaggccaatcagaagtttggaagaagaaatatcacaaagaaatgggaag
gcagctgatctttctcatataaagaaaaagaaaaagaggaagcacagatcctggatagaa
gttgctgcatctcttattcaggaagaacaaacacagagttgcaatagtgagataggaaca
aagttatgtttagatgtggctgttaatgggctggaagaagaaagtgaaaaccaagagatg
aatgacagtcacaaaggagatatgactgatgcccactaccttagcaagaagaaggagaaa
aaaagaaagagaatggaggaatgtaatgaagaacattgtcattatcagaaatcatctttg
gatagcagctgctctatttgggacaaggaagaaccagagtccattacagagactccaagg
aaaaagaaaaaaaagaaaagaaagcaagattcagaacaggaaggagaagaaaatgagcac
caaaaacaccagagaaaggactgccaaaatgaccccaaggtcatccctaaagaaaacact
ttttgcaaggatagcaatcagtctcaagctttgaatggccagcatcctggaaatgttgct
ccatatatgtttttggagaagaaacaggctcctcttcagctctggaatagagagaaagaa
tctaatgtagtccaggaattgctcaagtattcatctgataaagcttatgggaaaaaagtt
ttgacatgggatggtgagatgtcagccatcagtcaagatgccattcagtatagtagactg
gcccagaatgagacagtgattgatgactgggacaaagaatttgactttgggaaggaaaag
aaaactaagaagttcaagcgagagaagaggagaaactttaatgccttccagaaacttcag
agtaggcggaacttttggtctgtgacccatcctgctaaggttacaagccttagttatcgc
cgctga

DBGET integrated database retrieval system