KEGG   Monodelphis domestica (opossum): 100026585Help
Entry
100026585         CDS       T01031                                 

Gene name
USP36
Definition
ubiquitin specific peptidase 36
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 1133 aa AA seqDB search
MPIVDKLKEALKPGRKDSTDDGDLGKLLASSAKKVLLQKIEFEPASKSFSYQLESLKSKY
VLLNPKTESAGRHKSCDEAHIRRQGSDHGFESCSDGVPAPQKVLFPVERLSLKWERIYRV
GAGLHNLGNTCFLNSTIQCLTYTPPLANYLLSKEHTRNCHQGGFCMLCVMQNHMIQAFAN
SGNAIKPVSFIRDLKKIARHFRFGNQEDAHEFLRYIIDAMQKACLNGYTKLDRQTQATTL
VHQIFGGYLRSRVKCSVCKSVSDTYDPYLDVALEIRQAANIVRALELFVKPDVLSGENAY
MCAKCKKKVPASKRFTIHRTSNVLTLSLKRFANFSGGKITKDVGYPEFLNIRPYMSQSNG
DPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLVHSSNIKVVLNQQAYVLFY
LRIPGSKKSPEGPIAKTASALPTRTNNVVPEHIKKNISNGIVPSPLIGKKLDLVSVKKLQ
TAEENGVPVSRNSFVVGLKSQNGSVQLKLPLGSLSPKLCSKPIHGPIILDKLGKKVKKPL
SLQHLSPSLKMSQGLNGISNLSSTKLESRRQSSWESKNAVLATSPKLLPEVTINGHGPKS
NGECSDPKRKDSISSSPEYSSSGETARGPETSKSGVGCFYTSQETDYSAGERAKEPPGGE
DSKMVKLKSPVLTNTATEPTSIMSPPPAKKLALSSKKASTLRRATANDLHSPPHSSFADH
TYPTKITHPVFTSSWPVSKIRAVSPLKSSNTMKSAFNSYSIKASPLPSSLRPSGMTEPHS
CSFASNPLPQVNGDFVSPSHQQQGTSSAPYSFSKKRRKKHIGEDRPIRSLEEEISQRNGK
AADLSHIKKKKKRKHRSWIEVAASLIQEEQTQSCNSEIGTKLCLDVAVNGLEEESENQEM
NDSHKGDMTDAHYLSKKKEKKRKRMEECNEEHCHYQKSSLDSSCSIWDKEEPESITETPR
KKKKKKRKQDSEQEGEENEHQKHQRKDCQNDPKVIPKENTFCKDSNQSQALNGQHPGNKK
QAPLQLWNREKESNVVQELLKYSSDKAYGKKVLTWDGEMSAISQDAIQYSRLAQNETVID
DWDKEFDFGKEKKTKKFKREKRRNFNAFQKLQSRRNFWSVTHPAKVTSLSYRR
NT seq 3402 nt NT seq  +upstreamnt  +downstreamnt
atgccaattgttgataagctaaaggaagctctgaaacctggtcggaaggattcaacagat
gatggtgatctggggaagctcttggcttcttctgccaaaaaagtcctcctacagaagata
gaatttgagcctgcgagcaagagcttctcttaccaattagagtccttaaagagcaaatat
gtactgttgaaccccaaaacagaaagtgctggtcgccataagagttgtgatgaggcacac
atcaggagacagggcagtgatcatgggtttgaaagctgtagtgacggtgttcctgcccca
cagaaagttctcttccctgtggaacgactatctttgaagtgggagcgcatttaccgagtt
ggagcaggtctccataacttaggcaacacctgcttcttgaactccaccatacagtgtttg
acctacacaccccctctagccaactacttgctctctaaggaacatactcggaattgtcac
caaggaggtttttgtatgctgtgtgttatgcagaatcacatgatccaggcctttgccaat
agtggcaatgctatcaagccagtctcctttatccgagacctgaaaaaaattgctaggcac
ttccgctttggaaaccaggaagatgcacatgaatttcttcggtacattattgatgctatg
caaaaggcctgcttgaatggctatacaaaattagatcgccagacacaggcaactacttta
gtccatcagatttttggaggttacctcagatctcgggttaagtgctcagtatgtaaaagc
gtctctgacacctacgatccctatttggatgttgcactggagatcaggcaagctgcaaat
attgtgcgtgccttggagctgtttgtaaaaccagatgttttgagcggagagaatgcttac
atgtgtgctaaatgcaagaaaaaagtaccagccagtaagcgcttcacaattcataggaca
tccaatgtcttaactctctctctgaagcgctttgcaaacttcagtgggggtaagattacc
aaggatgtgggatatccagaatttcttaatatacgtccatatatgtcccaaagtaatggt
gaccctgttatgtatggattatatgctgtacttgtccattcaggttatagctgccatgct
ggacattattactgttatgtcaaggctagcaatgggcagtggtatcagatgaatgattct
ttggtccattctagtaatatcaaagtggtcctgaatcagcaagcctatgttctgttctat
ctcagaattccaggctctaagaagagtcctgagggccccattgcaaaaactgcctctgcc
cttcctactcgaacaaacaatgtagttccagaacacatcaagaaaaatattagtaatggt
attgttccctcaccactaattggaaagaaattggacttggtatcggtgaaaaaattgcaa
acagcagaagaaaatggtgtcccagtttccagaaatagctttgtagtaggccttaaatca
caaaatggaagtgttcaactaaagctgcccttggggtccctgtccccaaaactttgttca
aagcctatccatggacccatcatactggataaactgggaaaaaaggttaagaagcctctc
tccctgcaacacctttctccctcactaaaaatgtctcaggggttaaatggcatcagcaac
ttaagcagcacaaaacttgagagtcgtaggcaaagctcatgggagagcaagaatgctgta
ctagctacctcacctaagctcctgcctgaagtgactatcaatggccatgggccaaagagt
aatggtgagtgttcagatcccaagaggaaggattccatcagctccagccctgaatactct
tccagtggtgagacagccagggggcccgagacctcgaagagtggagttggctgtttctat
acttctcaggaaacagactattctgctggtgagcgtgccaaagagccacctggtggagag
gattctaagatggtgaagttaaagtcccctgtcctgaccaatactgccactgagcctaca
agcatcatgtcccccccaccagccaaaaaactggccctttcttccaagaaggccagcacc
ctacggagggcgaccgccaatgacctccattcacctccccattcatcatttgctgaccac
acctaccccacgaaaatcacccaccctgtcttcacttcttcttggcctgtcagtaaaatc
agggctgtttcacctctcaaatcatcaaatactatgaagtctgccttcaactcctactca
atcaaagcttcaccactaccctccagcctcaggccttcaggaatgactgaaccacatagc
tgctcctttgcttccaatcccctgcctcaggtaaatggggactttgtgtccccttcacac
cagcagcaggggaccagcagtgccccttacagcttctccaaaaagagaaggaaaaagcat
ataggagaagacaggccaatcagaagtttggaagaagaaatatcacaaagaaatgggaag
gcagctgatctttctcatataaagaaaaagaaaaagaggaagcacagatcctggatagaa
gttgctgcatctcttattcaggaagaacaaacacagagttgcaatagtgagataggaaca
aagttatgtttagatgtggctgttaatgggctggaagaagaaagtgaaaaccaagagatg
aatgacagtcacaaaggagatatgactgatgcccactaccttagcaagaagaaggagaaa
aaaagaaagagaatggaggaatgtaatgaagaacattgtcattatcagaaatcatctttg
gatagcagctgctctatttgggacaaggaagaaccagagtccattacagagactccaagg
aaaaagaaaaaaaagaaaagaaagcaagattcagaacaggaaggagaagaaaatgagcac
caaaaacaccagagaaaggactgccaaaatgaccccaaggtcatccctaaagaaaacact
ttttgcaaggatagcaatcagtctcaagctttgaatggccagcatcctggaaataagaaa
caggctcctcttcagctctggaatagagagaaagaatctaatgtagtccaggaattgctc
aagtattcatctgataaagcttatgggaaaaaagttttgacatgggatggtgagatgtca
gccatcagtcaagatgccattcagtatagtagactggcccagaatgagacagtgattgat
gactgggacaaagaatttgactttgggaaggaaaagaaaactaagaagttcaagcgagag
aagaggagaaactttaatgccttccagaaacttcagagtaggcggaacttttggtctgtg
acccatcctgctaaggttacaagccttagttatcgccgctga

DBGET integrated database retrieval system