KEGG   Monodelphis domestica (opossum): 100026689Help
Entry
100026689         CDS       T01031                                 

Gene name
ALPL
Definition
alkaline phosphatase, liver/bone/kidney
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mdo00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 575 aa AA seqDB search
MALLSRTMELTVTTGLSLLFLMLILSLLCYFICRLARPLRFRRMSRSFGSTMFLLLLCLM
AGTCLSIVPEKEKNPWYWREQAQRTLQHSLKLQNLNTNVARNVILFLGDGMGVSTVTAAR
ILKGQLHHKLGEDFQLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKSNEGTVGVS
AAVTRSQCNTTKGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSADRDWYSDNE
MPPEALNQGCKDIAYQLMHNIPDIEVIMGGGRKYMFPKNTTDVEYGDDPKARGTRLDGQV
LIDVWKGKKPRNKNAHYVWNRMQLMNLDLNNVDYLLGLFEPSDMVYELNRNNKTDPSLSE
MVEVAIKILRKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIGLAGTLTSLEDT
LTVVTADHSHVFTFGGYTPRGNSIFGLAPVVSDTDNKPYTSILYGNGPGYKVVAGQRENV
STVDYAHDNYQAQSAVPLSYETHGGEDVAVFAKGPMAHLLHGVQEQNYIPHVMAYASCIG
SIMDHCQSHPSAGLAPQPALFSGLLTLLLLLSLLF
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcctgtccaggactatggagctgaccgtcaccacaggcctcagcctcctgttt
ctaatgctaatcctaagccttctttgttacttcatttgccgcctggccaggcccctcagg
ttcaggaggatgagcagatcctttggctctaccatgtttctcctgctcctttgcctgatg
gccggaacctgcctctccattgtaccagagaaggagaagaatccttggtactggagggaa
caggcccagcggaccctccaacattccctgaagctccagaacctcaacaccaatgttgcc
aggaatgtgatcctatttctaggggatggaatgggggtgtccaccgtgaccgctgcccgg
atcctcaaaggccagcttcaccacaagcttggagaggatttccagcttgagatggacaag
tttcctttcgtggctctgtccaagacatacaacaccaatgcacaggttcctgatagcgct
ggcacggccacagcctacctctgtggagtaaagagcaatgaaggcactgttggtgtgagt
gctgctgtcacccggtcacagtgtaataccacaaagggcaacgaggtcacctccatctta
cgctgggccaaggatgctggaaaatctgttggtattgtgaccaccacccgagtgaaccat
gctacgcctagtgctgcctatgcccactctgccgatagggattggtattctgacaacgag
atgccccccgaggccttaaaccagggctgcaaggacatcgcctaccagctgatgcacaat
atcccagatattgaggtaatcatgggtggaggtcggaaatatatgtttcctaagaataca
actgacgtggagtatggggatgacccgaaggcaagaggaacaaggctggacggacaagtc
cttattgatgtctggaagggaaagaagcctaggaacaagaatgcccactatgtttggaac
cgcatgcagctgatgaatctggacttgaataatgtggactacctcctaggtctctttgag
ccatccgatatggtgtatgaactcaacaggaacaacaagacagacccatctctgagtgag
atggtggaggtggccatcaagatcctgagaaagaaccccaaaggcttcttcctgctggta
gaagggggcaggattgaccacggccaccatgagggaaaagccaaacaggcattgcatgag
gcggtagagatggatcgggccattgggcttgctggcaccttaacatccttggaggacact
ctgactgtcgtcacagcagaccactcccatgtcttcacctttggtggctacacccctcgg
gggaactccatctttgggcttgcccccgtggtgagtgacaccgacaacaaaccctacacc
tctatcctgtatggaaatggacctggctacaaggtggtggctggccagagggagaatgtt
tccactgtggactatgctcatgacaactaccaggcccagtcagcagtgcccctgagctat
gaaacacatgggggtgaagatgtggctgtgtttgccaagggccccatggctcatctcctg
catggcgtccaggaacaaaattacattccacacgtcatggcctacgcatcctgcatcggg
tccattatggaccactgccaatcacatccatcggctgggctggccccacaaccagcactg
ttttcaggccttctcactcttctcctcctgctcagcctcttattctaa

DBGET integrated database retrieval system