KEGG   Monodelphis domestica (opossum): 100026752Help
Entry
100026752         CDS       T01031                                 

Gene name
MAP2K7
Definition
mitogen-activated protein kinase kinase 7
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Protein processing in endoplasmic reticulum
Osteoclast differentiation
Toll-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
GnRH signaling pathway
Influenza A
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100026752 (MAP2K7)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100026752 (MAP2K7)
   04012 ErbB signaling pathway
    100026752 (MAP2K7)
   04668 TNF signaling pathway
    100026752 (MAP2K7)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100026752 (MAP2K7)
   04660 T cell receptor signaling pathway
    100026752 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    100026752 (MAP2K7)
  Endocrine system
   04912 GnRH signaling pathway
    100026752 (MAP2K7)
  Nervous system
   04722 Neurotrophin signaling pathway
    100026752 (MAP2K7)
  Development
   04380 Osteoclast differentiation
    100026752 (MAP2K7)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100026752 (MAP2K7)
   05169 Epstein-Barr virus infection
    100026752 (MAP2K7)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100026752 (MAP2K7)
Protein kinases [BR:mdo01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100026752 (MAP2K7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 435 aa AA seqDB search
MAASSLEQKLSRLEAKLKQENREARRRIDLILEISPHRPRPIIVITLSPAPAPSQRAALQ
LPLANDGGSRSPSSDSSPQQPTPPARPRHMLGLPPPLFMPRSMESIEIDQKLQEIMKQTG
YLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFKKTGHILAVKQMRRSGNKEENKRIL
MDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRIQGPIPERILGKMTV
AIVKALYYLKEKHGVIHRDVKPSNILLDDRGQIKLCDFGISGRLVDSKAKTRSAGCAAYM
APERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLP
SNMGFSVDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYEMLEVDVASWFKDVMAKTESP
RTSSILSQHHLPFFR
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcctccctggaacagaagctatcccgcctggaggcgaagctgaagcaggaa
aaccgcgaggcccggcggaggatcgacctcatcctggagatcagtccgcatcggcccagg
ccgattattgtgatcactctaagccctgctcctgccccgtcccaacgagcagctctgcag
ctccctctggccaatgatgggggtagccgatcgccatcctctgacagctcccctcagcaa
cccaccccaccagctcgtccccggcatatgttggggctcccaccaccactgttcatgcca
cgtagcatggagagcatagaaattgaccagaaactacaggaaatcatgaaacagacagga
tacctgaccattggaggccagaggtaccaggcagagattaatgacctggagaacctgggt
gagatgggcagtggcacatgtggccaggtctggaagatgcgattcaagaagacaggccac
atccttgctgtcaagcaaatgcgacgctctggaaacaaggaagagaacaaacgaattctc
atggacctggatgtggtgctcaagagccatgactgtccatacattgttcaatgctttggg
acgttcatcacaaatacagacgtcttcattgccatggaacttatgggcacctgtgctgaa
aaactaaagaagagaattcaagggcccatcccagagcggatcttaggcaagatgactgtg
gctattgttaaggcgctctattacctgaaggagaagcatggtgtgatccacagagatgtg
aagccctccaacatcctacttgatgatcggggccagatcaagctctgtgactttggtatc
agtggccgtctggtagactccaaagccaagacgagaagtgctggctgtgcagcttacatg
gcgccggagcggatagaccctccagatcctaccaagcctgattatgacatccgagcagat
gtatggagcctgggaatctcactggtggagctggcaactgggcagttcccctacaagaac
tgcaagactgattttgaggtcctcaccaaggtcctgcaggaagaaccaccccttctgccc
agtaatatgggcttctcggtggactttcagtcctttgttaaagactgccttactaaagat
cacaggaagagaccaaagtacaataagctacttgaacacagcttcatcaaacgatacgaa
atgttggaagtggatgtggcatcctggttcaaggatgtcatggcgaagacagagtccccc
cggactagcagcatcttgagccaacatcaccttcccttcttcaggtag

DBGET integrated database retrieval system