KEGG   Monodelphis domestica (opossum): 100026794Help
Entry
100026794         CDS       T01031                                 

Definition
thymidine kinase 1, soluble
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mdo00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:mdo00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 234 aa AA seqDB search
MSCINLPTVLPGSPSKVRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSKNFSTHDRNTMEALPACLLRDVAQNALAVTVIGIDEGQFFPDIVEFSETMANAGKTII
VAALDGTFQRKAFGNILNLVPLAESVVKLTAVCMECFREAAYTKRLGIEKEVEVIGGADK
YHSVCRLCYFKKVSGQSTGLENKENCPQSGKPGDTTSCRKLFPSQQILQCSSSN
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcattaacctgcccaccgtactacccggctcccccagcaaagtccgggggcaa
atccaggtgatcctggggcctatgttctccgggaaaagcaccgagctcatgcgtagagtc
cgacgattccagatcgcccagtacaagtgcctcgtgatcaagtatgccaaagacactcgg
tacagcaaaaatttctccacacatgaccggaacactatggaagcactgccagcctgcttg
cttcgggatgtggcgcagaatgccctggctgtgactgtcattggtattgatgagggacag
tttttcccagatattgtggaattcagtgagaccatggcaaatgctgggaagacaataatt
gtagctgcactagatgggacctttcagaggaaggcatttgggaatatcctaaacttggtg
ccactggcagagagtgtggtgaaactaacagcagtgtgcatggagtgcttccgggaagct
gcttataccaagagactggggattgagaaagaggttgaggtgatcggtggtgctgacaaa
tatcactctgtgtgtcgactctgctatttcaagaaagtctcaggacaatctactgggctg
gagaacaaagagaactgcccccagagtgggaagccaggagataccacaagctgtcggaaa
ctctttcctagtcaacagattctacaatgtagttcaagcaactga

DBGET integrated database retrieval system