KEGG   Monodelphis domestica (opossum): 100026794Help
Entry
100026794         CDS       T01031                                 

Definition
thymidine kinase 1, soluble
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100026794
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100026794
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     100026794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 234 aa AA seqDB search
MSCINLPTVLPGSPSKVRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSKNFSTHDRNTMEALPACLLRDVAQNALAVTVIGIDEGQFFPDIVEFSETMANAGKTII
VAALDGTFQRKAFGNILNLVPLAESVVKLTAVCMECFREAAYTKRLGIEKEVEVIGGADK
YHSVCRLCYFKKVSGQSTGLENKENCPQSGKPGDTTSCRKLFPSQQILQCSSSN
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcattaacctgcccaccgtactacccggctcccccagcaaagtccgggggcaa
atccaggtgatcctggggcctatgttctccgggaaaagcaccgagctcatgcgtagagtc
cgacgattccagatcgcccagtacaagtgcctcgtgatcaagtatgccaaagacactcgg
tacagcaaaaatttctccacacatgaccggaacactatggaagcactgccagcctgcttg
cttcgggatgtggcgcagaatgccctggctgtgactgtcattggtattgatgagggacag
tttttcccagatattgtggaattcagtgagaccatggcaaatgctgggaagacaataatt
gtagctgcactagatgggacctttcagaggaaggcatttgggaatatcctaaacttggtg
ccactggcagagagtgtggtgaaactaacagcagtgtgcatggagtgcttccgggaagct
gcttataccaagagactggggattgagaaagaggttgaggtgatcggtggtgctgacaaa
tatcactctgtgtgtcgactctgctatttcaagaaagtctcaggacaatctactgggctg
gagaacaaagagaactgcccccagagtgggaagccaggagataccacaagctgtcggaaa
ctctttcctagtcaacagattctacaatgtagttcaagcaactga

DBGET integrated database retrieval system