KEGG   Monodelphis domestica (opossum): 100026890Help
Entry
100026890         CDS       T01031                                 

Gene name
PTPRC
Definition
protein tyrosine phosphatase, receptor type, C
Orthology
K06478  
receptor-type tyrosine-protein phosphatase C [EC:3.1.3.48]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Cell adhesion molecules (CAMs)
T cell receptor signaling pathway
Fc gamma R-mediated phagocytosis
Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100026890 (PTPRC)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    100026890 (PTPRC)
   04666 Fc gamma R-mediated phagocytosis
    100026890 (PTPRC)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    100026890 (PTPRC)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100026890 (PTPRC)
Cellular antigens [BR:mdo04090]
 Proteins
  100026890 (PTPRC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 1287 aa AA seqDB search
MFLWLKLLTFGFAFLDTDIFVTGQMTPNGLAGPSESEKPYTPFPTGPPPTHSTASLPASI
SERETGATGTIPPLNPHITPGAPPTKSTHLTTHAVSQAPSDGSVNQTLSSSPAVLTTLIA
DRANKSTDHIPERLTPTSLPADSSSASVTDLNPARNSSAVLPTLTTAITITDNTSDISDP
PIAPTIIATASKSSSTIPVTDTSTIAPSSRPVLCDRFKNISVTYEYNFRKFTACVNITEN
ETRYLYPTSDGCYGNLTECSSINIYVIPCPNENFTLYVPPAKDQFNLVNITEVEEADTSI
SLRWTYNRNFDCTQPLIFSFECKDPNGTIHSKKSEQYMTKFNNLIPDTDYICHASVNYER
HLVQQDQINIKTDFRTPGETTNLTLSATETEMNISWVAPSGTFHGFLIHSNRFSEDIKLS
NASTNHILQDLQPYEMYDISVRAFTSGKTQRYGKEVTDSVRTDIGKPSKVNDMEIKLEGD
NLIKVECKEPDKIYGPKLVYHLNMTSLYGLKSENNSTCKFIFNNLHFMTNYTFKLYTYNG
KHYGDAVVKSEVTRYNSHALIMFLIFLIVVTSLALLIVLYKIYDLHKKRSSSTDEQIGLV
EKDDEKQIMNVEPIPSEMLLETYKRKVADEGRLFLAEFQSIPRIFSKFSSKDARKPFNQN
KNRYVDILPYDYNRVELSEVNGDAGSDYINASYVDGFKEPRKYIAAQGPREETVDDFWRM
VWEQKVTVIVMVTRCEEGNRNKCAEYWPTVEVGTQTYGDVIVKINEHKRCPDYIVQKLNI
TNKRERTNGRDVTHIQFTSWPDHGVPDDPHLLLKLRRRVNAFSNFFSGPIVVHCSAGVGR
TGTYIGIDAMLEGLEAENRVDVYGYVVKLRRQRCLMVQVEAQYILIHQALVEYNQFGETE
VGMSELHSYLNNMKKRDPPSEPSPLEAEFQRLPSYRNWRSQHTGNQEENKNKNRNSQIIP
YDFNRVLLKHELETSKESEHDSEESSDDDSDTDEPSKYINASFITTYWKPEVMIATQGPL
KETIADFWQMVFQRKVKVIVMLTDLKDGEQDVCAQYWGEGKQKYEDVEVEIKDMNKTTAY
TIRVFELRHAKRKDARTVYQYQYNSWKGEELPASPRELISMIRNFKEKLPKKHSTEAQKH
HKTASLLIHCRDGSQQTGMFCALLNLLDCADTEDVIDVFQVVKSLRRARPEMVSSFEQYQ
FLYDVIANTYPAQNGQVKKSSHQEDKIEFDNEVDIPNQVANCVSSSADLDKAQDKSRKAE
EPQNTDGTKETESSSNGPTSTTLTESA
NT seq 3864 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgtggcttaaactcttgacatttggctttgcatttctggacactgatatcttt
gtcacaggacaaatgacacctaatggcttggcaggaccaagtgaaagtgaaaagccctat
actccatttccaactggcccaccacctactcactccactgcatccttacccgcaagcatc
tctgaaagagaaactggtgccacagggaccattcctcctcttaacccacatataactcca
ggtgcaccaccaaccaagagcactcaccttaccacgcacgcagtctctcaagctccttct
gatggatctgtcaatcaaacactcagcagcagtcctgctgtccttaccacactcatcgct
gatagagcgaataaatcaacagatcatataccagaaaggcttacacccacctctttacct
gcagactcgagctctgcatcagtaacagatctcaatccagcacgcaacagctctgctgtc
cttcctacactcactactgccatcaccatcactgataatacttcagatatttctgatcct
ccaattgctccaacaatcatagccacagcaagcaaatcctcaagcactatccctgtcacg
gacacttcaacaatagcacctagttcaagacctgttctatgtgatcgattcaaaaatatt
tctgtgacttatgaatacaattttagaaaatttactgcatgtgttaatattactgaaaat
gagaccagatatttatacccaacttctgatggttgctatggtaacctcactgaatgctct
tcgatcaatatatatgtaataccatgcccaaatgaaaacttcacattatatgtgccacca
gctaaagatcagttcaacttggtaaacataacagaagttgaagaagcagatacttctatt
agtttaagatggacttataacaggaatttcgattgcacacagcctttaatcttcagtttt
gaatgtaaagatccaaatggcacaatacactcaaaaaaatcagaacagtacatgacaaaa
tttaataacttgatccctgatactgattatatttgccatgcttctgttaattatgaacgc
catcttgttcaacaagaccaaatcaacattaaaacagactttagaactcctggggagact
accaatttgacattatcagcaactgaaacagaaatgaacatttcttgggtggctccttct
ggcacttttcatggttttctcatccatagtaacaggttttctgaagatataaaactatca
aatgcttcaaccaatcatattctacaagacttgcaaccttatgaaatgtatgacatatca
gtaagagccttcacttcaggaaaaacacaacgatatggaaaagaagtgactgattctgtt
cgaacagatataggaaaaccaagcaaggttaatgacatggaaataaaattagaaggtgat
aatcttataaaagttgaatgcaaagagccagataaaatatatggccccaaattggtctac
cacttgaatatgacatctttgtatggtctgaaatcagaaaacaactcaacttgcaaattt
atattcaacaatcttcatttcatgaccaattatacatttaagctctacacttacaatggg
aagcactatggagatgcagttgttaaaagtgaagtaacaagatataattcccatgctttg
atcatgtttctgatatttttgattgttgtgacatcactagccttattaatagtcctttat
aaaatctatgatctgcacaaaaaaagatcaagtagtacagatgaacagataggacttgtt
gaaaaagatgatgaaaaacagataatgaatgtggagccaatcccttcagagatgttactg
gaaacatataagaggaaggttgctgatgagggaagactttttctggctgaatttcagagc
attccaaggatattcagcaaattttcaagcaaagatgcacgcaaaccctttaaccagaac
aaaaaccgttacgttgacatccttccctatgattataatcgtgttgaactctctgaagta
aatggagatgcaggatcagactatataaatgcaagttatgtggacggtttcaaagaacca
aggaaatatattgctgcacaaggtcctagagaagaaactgttgatgatttctggagaatg
gtctgggaacagaaagtaactgttattgtcatggtgactcgctgtgaagaaggaaaccgg
aacaagtgtgcagaatattggccaacagtggaagtgggcactcaaacatatggagatgtt
attgtaaagataaatgagcacaaacggtgtccagattacattgttcagaaactgaatatt
acaaataaaagggagagaacaaatgggagagatgtgacacatattcagttcaccagctgg
cctgaccatggggtcccagatgatcctcacctgctcctcaagttgcgtagaagagttaat
gccttcagtaactttttcagtggtcctattgttgtccattgcagtgctggtgttggccgt
acaggtacctacattggaattgatgctatgcttgagggactagaagctgaaaaccgagtg
gatgtttatggttatgtagtcaagcttcggcgacagagatgtctgatggttcaagtagag
gctcagtatatcctgatccatcaggctttagtagagtacaatcagtttggagaaactgaa
gtgggcatgtcggagctacattcctatctaaataacatgaaaaagagggatccacccagt
gagccttccccactggaggcagaattccagagacttccttcatataggaactggaggtcc
cagcacactggaaatcaagaagaaaataaaaacaaaaataggaattcccaaattattcca
tatgactttaacagagtgctcttgaaacatgaattggagaccagcaaagagagtgagcat
gattcagaagagtcatctgatgatgatagtgacactgacgagccaagcaaatatatcaat
gcttctttcataactacctattggaaacctgaagtgatgattgccacccaagggccatta
aaggagacaattgctgacttctggcaaatggtctttcaaagaaaagtcaaagttattgta
atgttgacagatctgaaagatggggaacaggatgtctgtgcccagtactggggagaagga
aaacagaaatatgaagatgtggaagtagaaataaaagacatgaacaaaactacagcttac
accatccgtgtatttgaactgagacatgcaaagaggaaagatgcccgaacagtttatcag
tatcaatataacagctggaagggggaagaacttcctgcctctcctagagaattaatctct
atgattagaaacttcaaagagaaacttccaaagaaacatagcactgaagcacaaaaacat
cacaagactgcctctcttcttattcactgcagggatgggtcacaacaaacaggaatgttt
tgtgctttgttaaatcttctggattgtgcagacacagaagatgtaatagatgtttttcaa
gtcgtgaaatctctgcgcagagccaggccagaaatggtttcatcctttgaacaataccaa
ttcctgtatgatgtcattgccaacacttaccctgcccagaatggacaagtaaagaaaagt
agtcaccaagaagataaaatcgaatttgacaatgaagtggacataccaaatcaggttgct
aactgtgttagctcatctgctgatctggataaggcccaagacaaaagcagaaaggctgaa
gagccccagaacacagatggcactaaggagacagaaagctcttcaaatggtcccacaagt
acaaccttaacagaaagtgcctag

DBGET integrated database retrieval system