KEGG   Monodelphis domestica (opossum): 100026890Help
Entry
100026890         CDS       T01031                                 

Gene name
PTPRC
Definition
protein tyrosine phosphatase, receptor type, C
Orthology
K06478  
receptor-type tyrosine-protein phosphatase C [EC:3.1.3.48]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Cell adhesion molecules (CAMs)
T cell receptor signaling pathway
Fc gamma R-mediated phagocytosis
Primary immunodeficiency
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:mdo04514]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:mdo04660]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:mdo04666]
Human Diseases; Immune diseases; Primary immunodeficiency [PATH:mdo05340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 1192 aa AA seqDB search
MYGNSIVISLPGSTNAPRQYSSELSGQMTPNGLGAPPTKSTHLTTHAVSQAPSDGSVNQT
LSSSPAVLTTLIADRANKSTDHIPERLTPTSLPADSSSASVTDLNPARNSSAVLPTLTTA
ITITDNTSGLILLTIKPPYMMDLDISDPPIAPTIIATASKSSSTIPVTDTSTIAPSSRPV
LCAKDQFNLVNITEVEEADTSISLRWTYNRNFDCTQPLIFSFECKDPNGTIHSKKSEQYM
TKFNNLIPDTDYICHASVNYERHLVQQDQINIKTDFRTPGETTNLTLSATETEMNISWVA
PSGTFHGFLIHSNRFSEEKKDINIPKNLIQHILQDLQPYEMYDISVRAFTSGKTQRYGKE
VTDSVRTDIGKPSKVNDMEIKLEGDNLIKVECKEPDKIYGPKLVYHLNMTSLYGLKSENN
STCKFIFNNLHFMTNYTFKLYTYNGKHYGDAVVKSEVTRYNSHALIMFLIFLIVVTSLAL
LIVLYKIYDLHKKRSSSTDEQIGLVEKDDEKQIMNVEPIPSEMLLETYKRKVADEGRLFL
AEFQSIPRIFSKFSSKDARKPFNQNKNRYVDILPYDYNRVELSEVNGDAGSDYINASYVD
GFKEPRKYIAAQGPREETVDDFWRMVWEQKVTVIVMVTRCEEGNRNKCAEYWPTVEVGTQ
TYGDVIVKINEHKRCPDYIVQKLNITNKRERTNGRDVTHIQFTSWPDHGVPDDPHLLLKL
RRRVNAFSNFFSGPIVVHCSAGVGRTGTYIGIDAMLEGLEAENRVDVYGYVVKLRRQRCL
MVQVEAQYILIHQALVEYNQFGETEVGMSELHSYLNNMKKRDPPSEPSPLEAEFQRLPSY
RNWRSQHTGNQEENKNKNRNSQIIPYDFNRVLLKHELETSKESEHDSEESSDDDSDTDEP
SKYINASFITTYWKPEVMIATQGPLKETIADFWQMVFQRKVKVIVMLTDLKDGEQDVCAQ
YWGEGKQKYEDVEVEIKDMNKTTAYTIRVFELRHAKRKDARTVYQYQYNSWKGEELPASP
RELISMIRNFKEKLPKKHSTEAQKHHKTASLLIHCRDGSQQTGMFCALLNLLDCADTEDV
IDVFQVVKSLRRARPEMVSSFEQYQFLYDVIANTYPAQNGQVKKSSHQEDKIEFDNEVDI
PNQVANCVSSSADLDKAQDKSRKAEEPQNTDGTKETESSSNGPTSTTLTESA
NT seq 3579 nt NT seq  +upstreamnt  +downstreamnt
atgtatggaaattctattgtcattagtcttccaggctccactaatgccccacgccaatac
tccagtgaactatcgggacaaatgacacctaatggcttgggtgcaccaccaaccaagagc
actcaccttaccacgcacgcagtctctcaagctccttctgatggatctgtcaatcaaaca
ctcagcagcagtcctgctgtccttaccacactcatcgctgatagagcgaataaatcaaca
gatcatataccagaaaggcttacacccacctctttacctgcagactcgagctctgcatca
gtaacagatctcaatccagcacgcaacagctctgctgtccttcctacactcactactgcc
atcaccatcactgataatacttcaggtttgattcttcttaccattaaacctccatatatg
atggatcttgatatttctgatcctccaattgctccaacaatcatagccacagcaagcaaa
tcctcaagcactatccctgtcacggacacttcaacaatagcacctagttcaagacctgtt
ctatgtgctaaagatcagttcaacttggtaaacataacagaagttgaagaagcagatact
tctattagtttaagatggacttataacaggaatttcgattgcacacagcctttaatcttc
agttttgaatgtaaagatccaaatggcacaatacactcaaaaaaatcagaacagtacatg
acaaaatttaataacttgatccctgatactgattatatttgccatgcttctgttaattat
gaacgccatcttgttcaacaagaccaaatcaacattaaaacagactttagaactcctggg
gagactaccaatttgacattatcagcaactgaaacagaaatgaacatttcttgggtggct
ccttctggcacttttcatggttttctcatccatagtaacaggttttctgaagagaaaaag
gacatcaatatcccaaaaaatctgattcagcatattctacaagacttgcaaccttatgaa
atgtatgacatatcagtaagagccttcacttcaggaaaaacacaacgatatggaaaagaa
gtgactgattctgttcgaacagatataggaaaaccaagcaaggttaatgacatggaaata
aaattagaaggtgataatcttataaaagttgaatgcaaagagccagataaaatatatggc
cccaaattggtctaccacttgaatatgacatctttgtatggtctgaaatcagaaaacaac
tcaacttgcaaatttatattcaacaatcttcatttcatgaccaattatacatttaagctc
tacacttacaatgggaagcactatggagatgcagttgttaaaagtgaagtaacaagatat
aattcccatgctttgatcatgtttctgatatttttgattgttgtgacatcactagcctta
ttaatagtcctttataaaatctatgatctgcacaaaaaaagatcaagtagtacagatgaa
cagataggacttgttgaaaaagatgatgaaaaacagataatgaatgtggagccaatccct
tcagagatgttactggaaacatataagaggaaggttgctgatgagggaagactttttctg
gctgaatttcagagcattccaaggatattcagcaaattttcaagcaaagatgcacgcaaa
ccctttaaccagaacaaaaaccgttacgttgacatccttccctatgattataatcgtgtt
gaactctctgaagtaaatggagatgcaggatcagactatataaatgcaagttatgtggac
ggtttcaaagaaccaaggaaatatattgctgcacaaggtcctagagaagaaactgttgat
gatttctggagaatggtctgggaacagaaagtaactgttattgtcatggtgactcgctgt
gaagaaggaaaccggaacaagtgtgcagaatattggccaacagtggaagtgggcactcaa
acatatggagatgttattgtaaagataaatgagcacaaacggtgtccagattacattgtt
cagaaactgaatattacaaataaaagggagagaacaaatgggagagatgtgacacatatt
cagttcaccagctggcctgaccatggggtcccagatgatcctcacctgctcctcaagttg
cgtagaagagttaatgccttcagtaactttttcagtggtcctattgttgtccattgcagt
gctggtgttggccgtacaggtacctacattggaattgatgctatgcttgagggactagaa
gctgaaaaccgagtggatgtttatggttatgtagtcaagcttcggcgacagagatgtctg
atggttcaagtagaggctcagtatatcctgatccatcaggctttagtagagtacaatcag
tttggagaaactgaagtgggcatgtcggagctacattcctatctaaataacatgaaaaag
agggatccacccagtgagccttccccactggaggcagaattccagagacttccttcatat
aggaactggaggtcccagcacactggaaatcaagaagaaaataaaaacaaaaataggaat
tcccaaattattccatatgactttaacagagtgctcttgaaacatgaattggagaccagc
aaagagagtgagcatgattcagaagagtcatctgatgatgatagtgacactgacgagcca
agcaaatatatcaatgcttctttcataactacctattggaaacctgaagtgatgattgcc
acccaagggccattaaaggagacaattgctgacttctggcaaatggtctttcaaagaaaa
gtcaaagttattgtaatgttgacagatctgaaagatggggaacaggatgtctgtgcccag
tactggggagaaggaaaacagaaatatgaagatgtggaagtagaaataaaagacatgaac
aaaactacagcttacaccatccgtgtatttgaactgagacatgcaaagaggaaagatgcc
cgaacagtttatcagtatcaatataacagctggaagggggaagaacttcctgcctctcct
agagaattaatctctatgattagaaacttcaaagagaaacttccaaagaaacatagcact
gaagcacaaaaacatcacaagactgcctctcttcttattcactgcagggatgggtcacaa
caaacaggaatgttttgtgctttgttaaatcttctggattgtgcagacacagaagatgta
atagatgtttttcaagtcgtgaaatctctgcgcagagccaggccagaaatggtttcatcc
tttgaacaataccaattcctgtatgatgtcattgccaacacttaccctgcccagaatgga
caagtaaagaaaagtagtcaccaagaagataaaatcgaatttgacaatgaagtggacata
ccaaatcaggttgctaactgtgttagctcatctgctgatctggataaggcccaagacaaa
agcagaaaggctgaagagccccagaacacagatggcactaaggagacagaaagctcttca
aatggtcccacaagtacaaccttaacagaaagtgcctag

DBGET integrated database retrieval system