KEGG   Monodelphis domestica (opossum): 100027090Help
Entry
100027090         CDS       T01031                                 

Gene name
ITGA8
Definition
integrin, alpha 8
Orthology
K06584  
integrin alpha 8
Organism
mdo  Monodelphis domestica (opossum)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mdo04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:mdo04512]
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:mdo04514]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mdo04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:mdo04510]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:mdo05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:mdo05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:mdo05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 1063 aa AA seqDB search
MAQGGPRCPAVGSREQLRAPLWGFWTALGMLCSPVSQAFNLDVDKLTVYSGPEGSYFGYA
VDFHIPDQRTVSILVGAPKANTSQPDIVEGGAVYYCPWPATGDVHCKQIPFDTTNNRKIR
VNGTKEPIEFKSNQWFGATVKAHKGKVVACAPLYHWRTLKATREKDPVGTCYVAIQNFSA
YAEYSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITANIADIIANY
SFKDILRKLTREKQTEVAPASYDDSYLGYSVAAGEFTGDSQQEILAGVPRGAQNFGYVSI
INSTDMTFIQNFTGEQMASYFGYALSVSDVNNDGLDDVLVGAPLFMEREFESSPKEVGQV
YLYLQESPLLFRDAQVLSGTEVFGRFGSAITHLGDLNQDGYNDIAVGAPFAGEAGRGKVF
IYNGNAEGLNQKPSQILNGAWASQAVPSGFGFTLRGDSDIDKNDYPDLIVGAFGTGKVVV
YRARPVVTVDAQLLLHPMIINLENKTCQIPSLATLVPCFTLRVCASVEGQSISNTVGLIA
DVQLDSLKQKGAIKRTLFRDNHQSQFVFPLVINQYQSLQCQDFIIYLRDETEFRDKLSPI
NISLNYSLDESTFEEGLAVKPILNFYRESIVNEQAHILVDCGDDNMCIPDLKLSAVPDKE
QLIIGDENHLMLIINARNGGEGAYEAELFVLIPEEADYVGIERNNKALHPLSCEYKMDNV
TRMVVCDLGNPMAAGTNYSLGLRFAVTHLENTNTSIDFDLQIRSSNKDNPDSNSVSLKIN
VTAVAQVEIRGVSHPPQIVLPIHNWEPEEEPHKEEEVGPLVEHIYELHNIGPSTISETLL
TVGWPNSAREEFLLYIFHIQTLGPLQCQTNPAINSLGIKPAASQEDTPALSAFLRNSSIP
HIVRKRHVPVVELHRQSPAKILNCTNIECLRISCVVGRLEGGESAVLKVRSRLWAQTFLQ
RKNDPYSLASIVSFEVKKMPYNEQPAQLPKGNVAIRTSVIWATPNVSFSIPLWVIILAIL
LGLLVLTLLTLALWKCGFFDRARPPQDDMADREQLTNDKVPDA
NT seq 3192 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggcggcccccgctgcccagcggtggggagccgggagcagctgcgggcgccc
ctctggggcttctggacagccctggggatgctctgctcgcctgtttcccaggcattcaac
ctggacgtggacaagctcactgtgtacagcggtcctgaaggcagctacttcggctacgct
gtggacttccacatacctgaccagcgaacagtgagtatcttggtgggggctcccaaagcc
aacactagccagccggatatagtggaaggtggcgctgtctattactgcccctggccggcc
acgggggatgttcactgtaagcagatcccgttcgacactactaacaatagaaaaattaga
gtcaatggaaccaaggaacctattgaatttaaatcaaatcagtggtttggagcaacagtg
aaagctcataaagggaaagtggtggcctgcgctcctttgtatcactggagaactctcaaa
gctacccgggaaaaggatcctgttggcacttgctacgtagcgattcagaatttcagtgca
tatgcagaatactctccttgtcggaacagcaatgctgatcctgaaggtcaaggttactgt
caagcaggcttcagtttggatttttacaagaatggagatctcatagtgggaggacctggc
agtttttactggcaaggccaggtgattacagccaacattgccgacatcattgccaattac
tcattcaaagatatcctaagaaaattgactcgagaaaagcaaactgaagttgcgccagca
tcctatgatgacagctaccttggatattccgttgctgctggagaatttaccggagattct
cagcaagaaatcctggctggtgttccacgaggtgcacagaattttggatatgtttcaatt
attaattcaacagatatgaccttcattcagaatttcactggggaacagatggcatcttat
tttggatatgctctttctgtatcagatgtcaacaatgatggccttgatgatgtattagtt
ggagcccctctcttcatggagcgtgaatttgagagcagccctaaagaagtgggacaggtt
tacctgtacttgcaagaaagccctttgctcttcagagatgcccaggtcctctcaggaact
gaagtgtttggcagatttggaagtgctattacccatttgggagatctgaatcaagatgga
tacaatgacattgcagttggtgcgccatttgcaggagaagctggaagaggcaaagtcttc
atttacaatgggaatgcagaagggttaaaccagaaaccttcccagattctgaatggagcc
tgggcctcccaggctgtgccatcgggatttggcttcactttgagaggtgattcagacata
gacaagaatgattacccagatttaattgtgggtgcctttggaactggaaaagtggttgtt
tatagagcaagaccagttgtgacagtggacgcccagcttctgctgcacccgatgattata
aaccttgaaaataaaacctgccagatccctagccttgcaacattggtgccttgctttact
ttgagagtgtgtgcatctgtagaaggtcagagcatttcaaatacagtaggtctgatagct
gatgtacagttagattcattgaaacagaagggagccattaagaggaccctcttcagggat
aaccatcagtcacagtttgtcttccctctagtaataaaccagtatcaatcactccaatgc
caagacttcattatttaccttcgagatgaaactgaattccgagataaattatctccaatc
aacattagcttgaattacagtttagatgaatccacttttgaggaaggtcttgctgtcaaa
ccaatactgaacttttaccgggagagcattgttaatgagcaggctcacatcctggtggac
tgtggagatgacaatatgtgcattcctgacttgaaactttcagctgtaccagacaaagag
cagctgatcattggagatgaaaaccacctaatgcttatcataaatgcaaggaatggaggg
gagggtgcctacgaagctgaactctttgtgctgatacctgaggaagcagattatgtcggt
attgaacgcaacaacaaggctctgcacccactgagctgtgagtacaagatggacaatgta
accagaatggtggtgtgtgacctggggaaccctatggcggctggaacaaattattcacta
ggcctccgatttgctgttacccatcttgaaaataccaatacaagcattgactttgatctc
caaatcagaagttccaacaaggataatccagacagcaattctgtgagcttgaaaatcaat
gtcactgctgtggcccaagtagagataagaggagtatcccatccaccacaaattgttctg
cccattcacaattgggaacctgaagaggaaccccacaaagaagaagaagttggaccatta
gtagagcatatttatgagctgcataatatcggacccagtactatcagtgaaacacttcta
actgtgggatggccaaattctgcccgagaggaatttcttctatatattttccatattcag
acccttggaccattgcagtgtcaaacaaaccctgctatcaactcactgggaataaagcca
gcagcctcccaggaggacactcctgccctcagtgcttttctgcgtaattctagcattcct
catattgtcaggaagagacatgtcccagtggtagagcttcacagacaaagtcctgcaaaa
atactgaattgcacgaacattgaatgcttgcgaatctcttgtgtggtcggacgattggaa
ggaggtgagagtgcagtcctgaaagtcagatcacgattatgggcccaaacttttctccag
agaaaaaatgacccctattctcttgcttccattgtgtcatttgaagttaagaagatgcca
tataatgaacagccagcacagcttcctaaaggaaatgtagctattagaacatcagtcatc
tgggcaactccaaatgtctccttctccatcccgttatgggttatcatattggccatactt
cttggactgctggtcctcacccttttgactttagctttatggaagtgtggattctttgac
cgagcaagacctccccaggatgatatggctgacagagagcaattaacaaatgacaaggtt
cctgatgcttga

DBGET integrated database retrieval system