KEGG   Monodelphis domestica (opossum): 100027109Help
Entry
100027109         CDS       T01031                                 

Gene name
GRIA4
Definition
glutamate receptor, ionotropic, AMPA 4
Orthology
K05200  
glutamate receptor 4
Organism
mdo  Monodelphis domestica (opossum)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Dopaminergic synapse
Amphetamine addiction
Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    100027109 (GRIA4)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100027109 (GRIA4)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    100027109 (GRIA4)
   04728 Dopaminergic synapse
    100027109 (GRIA4)
   04723 Retrograde endocannabinoid signaling
    100027109 (GRIA4)
  Environmental adaptation
   04713 Circadian entrainment
    100027109 (GRIA4)
 Human Diseases
  Substance dependence
   05031 Amphetamine addiction
    100027109 (GRIA4)
   05033 Nicotine addiction
    100027109 (GRIA4)
Ion channels [BR:mdo04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   100027109 (GRIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 902 aa AA seqDB search
MRIICRQLVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDASYRRLLEDLDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFMHGGANVTGFQLVDFNTPMVTKLMQRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRNLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDMPTLGNDTAAVENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMKSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGV
LDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHSGTTIRQSSGLAVIASD
LP
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaggattatttgcagacagcttgtcttgctattttctggattttggggactagcaatg
ggagcttttccaagcagcgttcaaataggtggtctattcatcagaaacacagatcaggaa
tatactgcttttcgattagcaatttttcttcataacaccagccccaatgcatcggaggca
ccttttaatttggttcctcatgtggacaacattgaaacagccaacagcttcgctgtaaca
aatgccttttgttctcagtattctcgaggagtttttgccatttttggactctatgacaag
aggtcagtacatactttgacctcattctgcagcgccttacacatctcccttatcacacca
agtttccctacggagggggagagtcagtttgtgctgcaattgagaccttctctccgagga
gcactcttgagtttgttggatcactatgaatggaactgttttgttttcctgtatgacaca
gataggggatactccatacttcaagctataatggagaaagcaggacaaaacggttggcat
gtcagtgccatatgtgtggaaaactttaatgatgccagctacaggcgccttctagaagac
ctggatcgtagacaagaaaagaaatttgtaatagactgtgaaatagagagacttcaaaac
atactggaacagattgtcagtgttgggaaacatgttaaaggataccattatatcattgca
aacctaggattcaaggatatttctctggagaggtttatgcatggaggagccaatgtaaca
ggattccagttagtagattttaatacacctatggtaaccaagcttatgcagcgctggaaa
aaactagatcaaagagaatatccaggatcagagacacctcccaagtacacatctgctctg
acatatgatggagtgcttgtgatggcagaaacttttcgcaatcttagacgacagaaaatt
gacatttcaaggagagggaatgcgggggattgcctagccaatcctgctgccccatggggc
caggggattgatatggagaggacactcaaacaggttcgaattcaaggattgacaggaaat
gtacaatttgaccattatggaagaagagtcaattacacaatggatgtatttgagctgaag
agtacgggacccagaaaggttggttattggaatgacatggataaactagttctaattcaa
gacatgcctacacttggaaatgatactgcagctgttgaaaataggacagttgttgtaacc
acaatcatggaatccccatatgttatgtacaagaaaaaccatgaaatgtttgaagggaat
gacaagtatgaaggctactgtgtagatttggcttctgaaattgcaaaacatattggtatc
aagtacaaaattgccattgttccagatggaaaatatggagcaagggatgcagatacaaaa
atctggaatgggatggtaggagaacttgtgtatgggaaagctgagattgctatcgcccca
ctaacaatcactttggtccgagaagaagttattgacttttcaaagcccttcatgagtttg
ggcatatccattatgattaaaaagccccagaaatctaaaccaggagtattttccttcttg
gatcctttggcctatgagatttggatgtgcatagtttttgcctacattggtgtcagtgtg
gtcttattcctagttagtcgatttagtccatatgaatggcacacagaagaaccagaggat
ggaaaagaaggaccaagtgaccagcctcccaatgagtttggcatttttaacagcctctgg
ttttccctgggtgcctttatgcagcaaggatgtgacatttcaccacgatccctttcagga
cgaattgttggaggtgtttggtggttctttactctcatcatcatctcttcttatacggca
aatcttgctgcattcctgactgttgagcgaatggtttccccaatagaaagtgcagaagac
cttgccaaacaaactgaaattgcatatggaacattggactctgggtcaacaaaagaattc
ttcagaagatcaaaaatagcagtatatgaaaagatgtggacctacatgaagtcagccgaa
ccttcagtgttcactaggactacagcagagggagtagcacgtgtccgcaagtccaaggga
aaatttgccttcctcctggagtctactatgaatgaatacattgaacaacgaaagccgtgt
gacaccatgaaagttggaggaaatctggattcgaaaggctatggagtagcaacgcctaag
ggttcctcattaagaactcctgtaaaccttgccgttttgaaactcagtgaggcaggcgtc
ttagacaagctgaaaaacaaatggtggtacgataaaggtgaatgtggacccaaggactct
ggaagcaaggacaagacgagtgccttgagcctgagcaacgtcgctggagtcttctacatt
ctggttggcggcttgggcttggccatgctggtggctttgatagagttctgttacaagtcc
agggcagaggcaaagcgaatgaagctgaccttttctgaagccataagaaacaaagccaga
ttatccatcacggggagtgtcggagaaaatggccgtgtattgactcccgactgcccaaaa
gctgtacactctggaactacaattagacaaagttcaggattggctgtaattgcatcggac
ctaccataa

DBGET integrated database retrieval system