KEGG   Monodelphis domestica (opossum): 100027137Help
Entry
100027137         CDS       T01031                                 

Gene name
USP42
Definition
ubiquitin specific peptidase 42
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 1371 aa AA seqDB search
MTIVDKVSESSNPSACQNQPGSSVAPSLGDMDSGSASWGAVSSLTDIPKHKISLGPVPGA
AIYSNSSISDKPKPSAQKDQSTGDGIAPPQKVLFPAEKICLKWQQSHRVGAGLQNLGNTC
FVNAALQCLTYTPPLANYMLSHEHSKICHEQGFCMMCTMQAHITQALNNPGNVIKPMPVI
NDLRRIAKHFRFGNQEDAHEFLRYTVDAMQKACLNGSTKLDRHSQATTLVCQIFGGYLRS
RVKCMNCKGVSDTFDPYLDIPLEIKAAQSVNKALEQFVKPEQLDGENSYKCSKCKKMVPA
SKRFTIHRSSNVLTLSLKRFANFSGGKIAKDVKYPEYLDIRPYMSQPNGEPIIYVLYAVL
VHTGFSCHAGHYYCYIKASNGQWYQMNDSIVSTSDIRSVLNQQAYVLFYIRSHDVKNGGE
HTHSIHTPGQSSPRPVINQRVVSSKQTVSGFIGPQLPPHMIKSSNHLNGTGPLKETPSCS
VASASSSNLNRASPAPASTSIQNWTVNRPSIIPEPPKKQKITISIHNKLPVRQGQSQPNL
HNNSLENLSKSIPSSTITNSSALQSTSNASTMSVATKVSKQITPSESCSKPVMNGKSKLT
SSVLVPYGAESSEESDEESKGLGKENGHAKPLNGLLTGNGVGMLPNTCSSCQDAEDDEAS
HHELPETVTVNGANSIENSDPKENGLSFDDPTCQVKPAKHSENPFSKTNGLHGKLMPTPL
PPLPEDRIVESFRFSNKLKSLTDDISSTGNEKSPEEHGTELVVGSNSSASFEQLEKVTSS
LSCKIKNNFPPSDPNVIATKEEIPESIIAKTEESIPNVISHCNANKKAIGDDQFPKQCDP
GNFTDEKLLLSQEVKGTLKENSLNSAPVDTVEKLSQTPSNNFDTECDSNKLLVFISTEKC
KETKDLSKSIDMSANELSATQLDKIVENHYSKGSTEQSNSERCEESKVRQKVQSNSPVKE
KGDSPRKVDRGHHHNRREHSSSGERTKQSRSKTETHYYKKRVSYSKERTKKGRHKSEHCN
GSKYKPFHNESSSPDSRSLGKHNHYRSRSRGKSDQERGRYYHSKSERSWSREKYYPDGMR
RWDKYRYYSDYYPYSSREGREWKPSHSDREYDKASQYNSRSHKDYYKSKWVHEPAPKEKE
RHHLNSNKVDLSHCSSLPQHPEKYSHDKIALENSSNLCSQFHEYESVKMRKRKYDSIENS
DSDIEKKIPKPLQNEPVEEQKVKKHKKSKKKKKSKDKHRARSCKHHQELDLSVVNSKADL
RKHKKKKKKKKKHAKKSEDYIEHSDLHVLKISCSETDNKTWEKKDKSPIKDGLPSEDYQK
FNKLSHEEDDDHPEKTKHLRMESQDHKCHPAEYGQGKGKHXELRMKNFILN
NT seq 4116 nt NT seq  +upstreamnt  +downstreamnt
atgactatagttgacaaagtatctgaatcttccaacccatcagcttgtcagaatcaacct
ggcagctcagtggcaccttcacttggagacatggactcaggctctgcaagttggggagct
gtatcttctttgacagacatccccaaacataaaatttctttaggaccagtacctggtgct
gcaatatattctaattcatctatatctgacaaaccaaagccatcagcacaaaaagatcaa
tctacaggtgatggcattgcacctccacagaaggtcctttttccagctgaaaaaatttgt
ctaaagtggcaacaatctcacagagttggagctgggctccaaaatctgggcaatacgtgt
tttgtcaatgctgcattgcagtgtttaacatatacgccacctcttgccaattatatgtta
tctcatgaacactccaaaatatgccatgagcaaggattctgtatgatgtgtaccatgcag
gcccatattacccaggcactcaataatcctggcaatgtcatcaaaccgatgccagtcatc
aatgatcttcgacgtatagctaaacacttccgttttggaaaccaggaagatgcccatgaa
tttcttcgatatactgttgatgcaatgcagaaagcatgcctgaatggcagcactaaattg
gaccggcactcccaagctaccactcttgtttgtcaaatatttggaggctacctgaggtct
cgagtaaagtgtatgaactgcaaaggagtttctgataccttcgatccataccttgatatt
ccattggaaataaaggctgcccagagtgtcaacaaggccttggaacagtttgtgaagcct
gagcaattagatggagaaaattcctataaatgtagcaagtgtaaaaagatggttccagct
tcaaagaggtttactatacatagatcatctaatgttcttaccttatctttgaaacgtttt
gcaaattttagtggtggaaaaattgccaaggatgtgaaatatcctgagtatcttgatatt
cgaccatatatgtctcaacctaatggagaaccaattatttatgttctatatgcagtgtta
gtgcatactggttttagctgtcatgctggtcattactactgttacataaaggctagtaat
ggacagtggtaccagatgaatgattccattgtttccaccagtgacatcagatcagtgctt
aatcagcaggcttatgtcctcttttatatcaggtcccatgatgtgaaaaatggaggtgaa
catactcattccattcatactccaggacagtcttctcctcgaccagtgatcaatcaacgg
gtagttagtagtaaacagactgtatcaggctttattggaccacaacttcctcctcatatg
ataaagagttctaatcacttaaatgggactggaccattgaaggaaactccaagttgttct
gtggcaagtgctagtagttctaatttaaacagagcaagtcctgctcctgcttcaacttct
attcaaaactggacagttaacagaccttcaattattcctgagcctcctaagaagcaaaaa
atcactatcagtattcataacaagttgcctgttcgacaaggtcagtctcaacctaatctt
cacaacaattctttagaaaacctcagcaagtccattccctcatctaccattactaattct
tctgcattacaatctacctcaaatgcatcaacaatgtcagttgctactaaagtatcaaaa
cagatcacacctagtgaatcttgttccaagccagtaatgaatggcaagtccaagctcacc
tccagtgtgctggtcccttatggtgcagagtcttcagaagaatctgatgaggagtcaaag
ggactgggtaaggagaatggccatgcaaaacctcttaatggacttctgactggaaatgga
gttggtatgctcccaaatacttgttcttcctgtcaagatgctgaagatgatgaggcttct
catcatgaactgccagaaactgtgacagtaaatggtgctaatagtatagagaatagtgac
cctaaagaaaatggactgtcatttgatgatcccacttgccaagtcaaacctgctaaacat
tcagaaaatcccttttccaagacaaatggattacatggaaagttgatgcctactcccttg
cctccacttccagaagatagaatcgtagagtctttcagattcagcaacaaattaaaaagc
ttgactgatgatataagttcaactggaaatgagaaatcgcctgaagaacatggtaccgaa
cttgtggttggtagcaacagttcagcttcctttgaacaactagagaaagttacttcaagt
cttagctgcaaaataaagaataactttccaccctcggatcctaatgtcattgctaccaaa
gaagaaattcctgaaagtattatagcaaaaacagaagagtctattcctaatgtcattagt
cattgtaatgctaacaagaaagccattggagatgatcagtttcccaaacagtgtgatcct
gggaatttcacagatgaaaagctcctactatcccaagaagtaaagggaacattaaaggag
aattcactgaactctgcaccagtggatacagtggaaaaattgagccaaactccctcaaat
aattttgacactgaatgtgatagtaataaactcttagtatttattagtactgaaaaatgc
aaagaaacaaaggacctttctaaaagtatagacatgtctgctaatgaactgtctgccacc
caattagataaaattgtagagaatcattattcaaaagggagcactgaacaaagtaatagt
gaacgatgtgaagaaagtaaagttagacaaaaagttcagagtaattctccagttaaggaa
aaaggtgatagccccagaaaagtggacagagggcatcaccataaccgaagagaacattct
tccagtggagaacgaacaaagcaaagcaggagcaaaacagagacacattattacaaaaaa
agagtctcctatagcaaagagaggaccaaaaaaggccgccacaaatcagaacactgtaac
ggaagcaaatataaaccgtttcataatgaaagcagtagccctgacagtaggtccttagga
aaacataaccattatcggtccagaagtagaggaaaatctgatcaggaaaggggtagatat
taccattctaaaagtgaacgatcttggagtcgagagaaatattatccagatggaatgaga
agatgggacaaatatagatattatagtgattattatccttattcttcaagggagggtaga
gagtggaagccatctcacagtgatcgggaatatgacaaagcaagtcagtacaatagtaga
tcacacaaggactattataaaagcaaatgggttcatgagccagcacctaaagagaaagaa
aggcatcacttgaacagtaataaagtagacctctcccattgttcatctcttcctcaacat
cctgaaaaatattctcatgacaaaattgcacttgaaaacagttcaaatctttgtagtcag
tttcatgagtatgaaagtgtgaaaatgaggaaaaggaaatatgatagcatagaaaatagt
gacagtgacatagaaaagaaaatccccaaacccttacaaaatgagccagtagaggagcag
aaagtaaagaagcacaaaaaatcgaaaaagaaaaagaaatccaaagacaaacacagagca
agaagctgcaagcatcatcaggaattggatctttctgtagtcaactccaaagctgacctt
cgcaaacacaaaaagaagaagaagaaaaagaagaaacatgcaaaaaaatcagaggactat
attgaacattcagatcttcatgtactcaaaatttcctgctctgagactgataacaaaact
tgggagaaaaaggacaaatctcccatcaaagatggcttgccatctgaggactaccagaaa
tttaataaactttctcacgaggaagatgatgatcaccctgagaaaaccaaacacttaaga
atggaaagccaggatcataaatgtcacccagctgagtatggccagggtaaggggaaacat
taggagttaagaatgaagaattttattttaaattaa

DBGET integrated database retrieval system