KEGG   Monodelphis domestica (opossum): 100027420Help
Entry
100027420         CDS       T01031                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100027420 (MGST2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100027420 (MGST2)
   00982 Drug metabolism - cytochrome P450
    100027420 (MGST2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100027420 (MGST2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100027420 (MGST2)
  Drug resistance
   01524 Platinum drug resistance
    100027420 (MGST2)
Enzymes [BR:mdo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100027420 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 145 aa AA seqDB search
MASHLVLLAAVSVLSVCQQSFFAWQVGKARLKYKISPPAITGSPAFERIFRAQQNCVEFY
PIFLITFWMAGWFFNQVLAAILGLAYMYARHHFFFGYSESAKQRLFGFRMSLGVLALLII
QAVVGIGYELWDEYMDLKFFKKLVF
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcaagccatttggtcctactggctgcagtctctgttctctctgtctgccagcaaagt
ttctttgcctggcaggtggggaaagcaaggctgaagtataagatctcacccccagcaatc
actgggtcgccagcatttgagaggatatttcgtgcacaacaaaactgtgtagagttttac
cccatcttcctgatcaccttctggatggctggatggttcttcaaccaagtcttagctgcc
attttgggcctagcctacatgtatgctcgtcaccacttcttctttggatattcagagtca
gctaagcaaaggctatttggcttccggatgagtctgggagttttggctttgctgatcatc
caggctgttgtgggaattggctatgaactttgggatgagtacatggacttaaaatttttc
aagaaattagtattctag

DBGET integrated database retrieval system