KEGG   Monodelphis domestica (opossum): 100027514Help
Entry
100027514         CDS       T01031                                 

Gene name
LAMB2, LAMC1
Definition
laminin, beta 2 (laminin S)
Orthology
K06243  
laminin, beta 2
Organism
mdo  Monodelphis domestica (opossum)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100027514 (LAMB2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100027514 (LAMB2)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100027514 (LAMB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100027514 (LAMB2)
   05222 Small cell lung cancer
    100027514 (LAMB2)
  Infectious diseases
   05146 Amoebiasis
    100027514 (LAMB2)
   05145 Toxoplasmosis
    100027514 (LAMB2)
Cell adhesion molecules and their ligands [BR:mdo04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-11 Extracellular matrix (ECM) components
      100027514 (LAMB2)
   VLA-6
      100027514 (LAMB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 1794 aa AA seqDB search
MRLILGHQGWGLGGPELWLLLLLIVLAKAVVQNPDLPSAGCSRGSCYPATGDLLVGRADR
LTASSTCGLRGPEPYCIVSHLQDEKKCFLCDSRHPFSARYPQSHRIQNVVTSFAPQRRSA
WWQSENGVSSVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSSDFGRTWRVYRYFSYDC
GSDFPGIPLAPPHRVDDVVCESRYSEIEPSTEGEVIYRVLDPAIPITDPYSSRIQDLLKI
TNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASQCARAPGAPSHA
EGMVHGACVCKHNTRGLNCESCQDFYHDLPWRPAEDGHSHACKKCECHQHSRSCHFDMAV
FLASGNTSGGVCDDCQHHTAGMHCEICRPFYYRDPTRDLRDPAVCRPCDCDPSGARDGGL
CDPHDDPMLGLVSGQCRCKEHVVGPRCQRCRDGYFGLSTTNPQGCQRCQCDPRGTVPGGP
PCDSNSGDCFCKRLVTGKHCDRCLTDHWGLSHDLLGCRPCDCDVGGALEPRCAEDSGQCR
CRRHMFGRRCDQVQPGYFLPFLDHLTLEAEKARGQALDVVERTARPGMTISWTGVGFVRL
REGQILEFLVDSVSQAMDYELLLRYEPQVPEQWAEVTLTVQRPGPISHSSPCGTTVAEDD
HFRGMLQPGARYVVLPYPVCLEPGVSYTLLLELTRAGGDARPGAPTPTLLLDSLVLLPRW
SSLEMFSSGDAGALERRATFERYRCHEEGLMPAKSPPSEACAPLLRSLAALLHNGALACQ
CDPQGSLSSECQPHGGQCPCKANVAGRRCDHCAPGTFGFGPSGCRACQCSPDGSFSSLCH
EASGQCPCRPGAFGLRCDRCQPGQWGFPSCRPCHCNGHSDECDPRTGACQRCRDHTAGDN
CERCTAGFYGNPVLASGGHCRPCPCPEGPGGQRHFATSCHQDRHSQQVVCHCQPGYTGPR
CEECAPGHFGDPQRPGGRCQPCECSNNIDPMDPEACDRRSGQCLRCLHHSEGPRCAHCRP
GYYGQAAHQSCRRCTCNFLGTERSQCPSQDKCRCDPGSGQCPCLPNIQGQSCDRCAPNFW
NLASGRGCQPCSCHPSHATSPSCNEFTGQCHCRAGFGGRTCTECQENHWGDPGLQCRACD
CDPRGIETPQCHHATGHCVCRPGVAGVRCDQCARGFSGVFPACQPCHACFGDWDRIVQGL
ASRTRALEQRSRELHQLGALGAFEKNFRLLGEKLGTVQGIVNARNATAAATLQLMATTED
LRHDIEEATGQLTRLEGELTDAQDENFNANHALSGLERDGRALNLTLRQLGQHLDVLKHS
NFLGAYDSIRQSHAQSSEAEYHANRSALAIPSPVSDSAATRRRAESLMGSQRDNFDRRNV
ANRRALGELAARANTLSLTGINELVCGAPGDAPCATSPCGGAGCRDEDGQRRCGGLNCQG
AAATADNALGRARHTQEELRRTLGDADGLVGKVAEARLQAGMARQRAQAALEKANETRGR
VERANQELRELIQNVKDFLSQEGADPGSIEAVATHVLELSIPASPAQIHHLAGEIAERVR
SLGDVDTILQRTAGDVRQAEQLLQDAQRARTRAQGEKQKAEMVQDALEEARRAQGAAKGA
IRGAAADTEGTEQTLGRVREKTAGAEQDLTMAAERTQRLDAQLDALKLKRAGNSLEATRA
EETANSAQGRAQEAEKLLKGQLGDRYQTVRELADRKAQGVLQAKERAERLRDEARGLLQD
AQDKLRRMYELEGTYEVNERALEDKAAQLDGLEAKMKGVLQSINQQIQIYNTCQ
NT seq 5385 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgatcttggggcatcaagggtggggcctagggggaccggagctgtggctgctg
ctgttgctaatcgtgttggccaaagctgtggttcagaacccggacctgccttcagctggc
tgttccaggggaagctgctacccagccactggagacctcctggttgggcgagcagacaga
ctgacagcctcatctacctgtgggctgagaggtcctgagccctattgcatagtcagccac
ctacaggatgagaaaaagtgtttcctgtgtgactctcggcatccattctctgcccgctat
cctcaaagtcaccgaattcagaatgtggtcaccagctttgccccacagcgacggtcagcc
tggtggcaatcagaaaatggagtgtcctctgtcactatccagctggacttagaagctgaa
ttccactttacccaccttattatgaccttcaagacattccgcccagctgcaatgctggtt
gaacgctcctcagactttgggaggacctggcgtgtctatcgctatttttcctatgactgt
ggctctgacttccctgggatccctctggccccacctcatcgagtggatgatgtggtctgc
gaatctcgatactcagaaattgagccatccactgagggggaggtcatctaccgtgttctg
gacccagctatccccatcacagatccctatagttcacggatccaggacctcctgaagatc
acaaacctccgagtgaacctgacacggcttcacactctgggggacaacctgctggacccc
cgtagggagatccgagaaaaatattattatgctctctacgagctggtcgtccgagggaat
tgcttctgctatggtcacgcctcccagtgtgctcgagctcctggtgctccatcgcatgct
gagggcatggtccatggtgcctgtgtttgcaagcacaacacccggggtctgaactgtgag
agctgccaggatttctaccatgacctgccctggcgcccagcagaggatggccattcccat
gcctgcaaaaagtgcgaatgtcaccaacactcccggagctgccactttgacatggctgtg
ttcctggcctccggcaacacaagcggaggagtgtgtgatgattgccagcatcacacagct
gggatgcactgtgaaatctgccgtcctttctactatcgagaccccacgagggatttgcgg
gacccagccgtatgccgcccatgtgattgtgacccttcgggggcccgagatggaggcctt
tgtgacccccacgatgaccccatgctggggcttgtctctggccagtgtcggtgtaaagaa
cacgtggtgggccccaggtgtcagcgctgcagggatggctactttggactcagcaccact
aacccccagggctgccagcggtgccaatgtgacccacgggggacagtgccagggggtccc
ccttgtgattctaacagtggggactgtttctgcaaacgtctggtgactggaaagcattgt
gaccgatgcctgactgatcactggggtctgagccatgatttgcttggttgccgcccatgt
gactgtgatgtaggaggtgccctggaaccccggtgtgccgaggactccgggcagtgccga
tgtcgccggcatatgtttgggcgacgctgtgaccaggtgcagccgggatacttcctgccg
ttcctggaccatctcaccttggaggctgagaaagcccgtgggcaggccctagacgtggtt
gaacggacagcacgccctggaatgaccatctcctggacaggtgtgggctttgttcggcta
cgggaaggtcagatcctcgagtttttggtggactcagtatcccaagctatggactatgaa
ctgctcctgcgatatgaaccccaggtcccagagcagtgggcagaagtgactctgactgtg
cagcgcccagggccaatatctcacagcagcccctgcggcaccactgtggctgaggatgac
cacttccgggggatgctccaacctggtgccaggtatgtggtcttgccctatcctgtctgt
ttggagcctggggtttcctatactcttctgctggagctgactcgggccggaggagatgct
cgccctggagcacccactcccaccttgctccttgactctctggtgctattgccccgatgg
tcatccctggagatgtttagctcaggggatgccggggccctagaacgacgggcaaccttt
gaacgctaccgctgccatgaggagggcctgatgcccgccaagagccccccatcagaggcc
tgtgctcctctcctccgaagtctggctgcgctgctccacaacggggccctggcctgccag
tgtgacccccagggctccctgagctctgagtgccagccccacggtggacagtgcccatgc
aaggccaacgtggctgggagacgctgtgaccattgtgctccaggaacctttggctttggc
ccttcaggctgcagggcctgccaatgtagccctgatggcagcttcagcagtctgtgtcac
gaggccagcgggcaatgcccctgccggcctggagcttttgggctacgctgtgatcggtgc
cagcctgggcagtggggcttccccagctgccgcccctgtcactgcaatgggcactcggat
gagtgtgatcctcgcacgggggcctgccagagatgccgggaccacacagcaggagacaac
tgtgagaggtgtacggctggcttctatggaaacccggtgctggcatccggtggccactgc
cggccttgcccttgtcctgagggcccagggggccagcgccactttgccacctcctgccat
caggacaggcactcccagcaggtggtctgccactgccagcctgggtacactggcccacgc
tgtgaagagtgtgcccccggacactttggggacccccagaggccaggaggccgatgccaa
ccgtgtgaatgcagcaacaacattgaccccatggaccctgaggcctgcgaccgtcgaagc
ggacagtgtttacgatgtctacatcactccgaggggcctcgatgtgcccactgtcgccct
gggtactatgggcaggccgcccaccagagctgccgaaggtgcacctgtaactttctgggc
acagaacgcagtcagtgcccttctcaagacaaatgccgttgtgacccaggcagtgggcag
tgcccgtgcctgcccaacattcagggacagagctgtgaccgttgtgcccccaatttctgg
aacctggccagcggacgaggctgccagccctgttcctgccaccctagccatgctaccagt
ccttcctgcaatgagttcacagggcagtgccattgccgagcaggcttcggaggccgcaca
tgcaccgagtgccaggagaatcactggggagatcctggcttgcagtgtcgggcctgtgat
tgtgacccgagaggcatcgagacccctcagtgccaccatgccacgggacactgtgtctgt
aggccaggggtggctggcgtgcgttgtgaccagtgtgcccgaggcttttctggtgttttc
cctgcatgccagccatgccatgcctgctttggggactgggaccggattgtgcaaggctta
gcctcccgcacgcgggcacttgaacaacgatctcgggaattacaccagctgggggccctg
ggggcctttgagaagaacttccgccttctgggagagaagttgggcaccgtgcagggcatt
gtgaatgcccgaaatgccacagctgctgccacattgcagcttatggccaccacagaggac
ctgaggcatgacattgaggaagccacagggcagctgaccagactggagggagagctgaca
gatgcccaggatgagaatttcaatgccaaccatgccctgagtggattggagcgggatgga
cgagctctcaatcttacactgagacagctggggcagcatctggatgtgctgaaacactcc
aactttctgggggcctatgacagtatccgtcagtcccatgcccagtcatcagaggctgaa
taccatgcgaaccgttcagccttggccatccccagccctgtgagtgactcagcagccaca
cgacgccgagcagagagcttgatgggcagccagagagacaactttgaccggaggaatgtg
gctaatcgtagggctctgggtgaactcgcagccagggccaacacccttagcctgacaggc
atcaacgagctggtatgcggggcccctggggatgctccctgtgccacaagcccctgtggc
ggggctggctgcagggatgaagacggacaacgccgctgcgggggcctgaactgccaggga
gcagcggccacagcagacaacgcgctgggccgggcccgtcacacacaggaggaattgcgg
aggacccttggagatgcagatggacttgtgggcaaagtggcagaagcaaggctgcaagcg
ggtatggctcggcagcgggctcaggcggccctggaaaaggccaacgagactcgtggccga
gtggagcgggcaaaccaggaacttcgagaactaatccaaaatgtcaaggacttcctgagt
caagaaggagctgaccctggcagcattgaggccgtggccacccatgtcctggagctgtcc
atcccagcatcacctgctcagatccaccatctggcaggggaaattgctgagcgagtgcgg
agcctcggggatgtggacaccattctgcagcgcactgcaggtgatgtgcgccaggctgag
cagcttctgcaggatgcccagcgggcccggacacgtgctcagggtgagaagcagaaggca
gagatggtgcaggatgcgcttgaagaagccagacgggcgcagggtgcagccaaaggcgct
atccgtggggcggcagctgacacagagggcactgagcagacattgggcagggttcgggag
aagacagctggagcagagcaggacctgactatggcagctgagcggacccagcggctggat
gctcagctagatgctttgaagttgaagagagctggaaacagcctagaagccacaagggct
gaagaaacagcgaacagtgctcagggccgggcccaggaggctgagaagctgctgaagggc
cagctaggtgaccggtaccaaacagtgagggaacttgctgatcggaaggctcagggtgtc
ctacaggctaaagagagggccgagaggctacgggatgaggcccggggactgctacaggat
gctcaagacaaactcaggaggatgtatgagctggaaggcacatatgaagtgaatgagcga
gccctggaggacaaagcagctcagttggatggcctggaggccaaaatgaaaggtgtcctt
cagtctatcaaccagcagattcagatctacaacacgtgtcagtga

DBGET integrated database retrieval system