KEGG   Monodelphis domestica (opossum): 100027533Help
Entry
100027533         CDS       T01031                                 

Definition
NADH-cytochrome b5 reductase 2-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mdo00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 306 aa AA seqDB search
MESSTGLDASLLIAVLVVGASVLLLSLKSMRSPKKKDMITLLDPSTKYSLPLIEKQEISH
DTKMFRFGLPTSDHILGLPIGQHVYLSAKVNGNLVIRAYTPVSSDEVKGHVDLVIKVYYK
NVHPKFPEGGKMSQYLDNMKIGDTIDFRGPNGLLIYNGQGKLAIKPDKKSDSKMKFAKNL
GMIAGGTGITPMLQLIRHITKDPNDHTKCSLIFANQTEEDILLKAELEDVVKNHPDKFSL
WYTLDRPPNDWKYSSGFINADMIKNHLPPPGDDTMILMCGPPPMIQFACQPNLEKLGYTQ
DMTFAY
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgtccacaggcctggatgcctcacttttgattgcggttttggtagttggtgca
tcagtattactactgtctttaaagagcatgagatccccaaagaagaaagacatgatcacg
ttactggatccaagtactaaatactcactgcccctgattgagaaacaggaaatcagccat
gataccaagatgttccggtttggacttcctacatcagatcacattttagggctccccata
ggtcaacatgtttatctctctgccaaagtcaatggcaatctagtgatcagagcctatact
cctgtttccagtgatgaagtgaaaggccacgtggaccttgttattaaggtttattataaa
aatgtgcaccctaagtttcctgaaggggggaagatgtcccaatacctggataacatgaag
ataggagataccatcgatttccgagggccaaatgggctcctgatttataatggacaaggt
aagctggcaatcaaaccagataagaagagtgactctaagatgaagtttgccaagaatttg
ggaatgattgctggcgggacaggaataacgccaatgctgcagctgattcggcatattacc
aaggaccctaatgatcacaccaagtgctcccttatctttgctaaccagactgaggaagat
atcctcctgaaagcggagctcgaagacgtggtgaagaatcatccggacaagtttagtctg
tggtacaccctggacaggccacctaatgattggaaatatagctccggattcattaatgca
gacatgatcaagaatcatctcccgccaccaggagacgataccatgattttaatgtgtggt
cctcctccaatgatccagttcgcctgtcaacccaacctggaaaaactgggctatactcaa
gacatgacttttgcctactaa

DBGET integrated database retrieval system