KEGG   Monodelphis domestica (opossum): 100027667Help
Entry
100027667         CDS       T01031                                 

Gene name
CHP1
Definition
(RefSeq) calcineurin like EF-hand protein 1
  KO
K17610  calcineurin B homologous protein 1
Organism
mdo  Monodelphis domestica (opossum)
Brite
Protein phosphatases and associated proteins [BR:mdo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100027667 (CHP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_5 SPARC_Ca_bdg RST
Motif
Other DBs
NCBI-GeneID: 100027667
NCBI-ProteinID: XP_001370994
Ensembl: ENSMODG00000000158
UniProt: F6XSG1
Position
1
AA seq 195 aa AA seqDB search
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgggttctcgggcctccacgttactgagggacgaagaactcgaggagataaaaaaagaa
accggcttttcccatagtcaaatcacccgtctctacagccgttttactagcctggacaaa
ggagagaatggtactctcagccgggaagacttccagaggattccagagcttgccatcaac
cccctgggagatcggatcatcaatgccttcttccctgagggagaggaccaggtaaacttc
cgtggcttcatgagaaccctggctcacttccgaccaatcgaagacaatgagaaaagcaaa
gatgtaaatggaccagaaccactcaatagccggagcaataaactacacttcgcttttcgg
ttatatgacttggataaagatgacaagatttcccgagatgaattgttacaggtactacgc
atgatggttggagtgaatatttctgatgagcagctgggcagcattgcagataggacaatc
caagaggctgaccaggatggggacagtgccatatcttttacagagtttgtcaaggttttg
gagaaggtggacgtagagcagaaaatgagcatccggtttctacactaa

DBGET integrated database retrieval system