KEGG   Monodelphis domestica (opossum): 100027701Help
Entry
100027701         CDS       T01031                                 

Gene name
ASNS
Definition
asparagine synthetase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100027701 (ASNS)
Enzymes [BR:mdo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     100027701 (ASNS)
Peptidases [BR:mdo01002]
 Cysteine Peptidases
  Family C44
   100027701 (ASNS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 201 aa AA seqDB search
SPFLPLRANAWRLCVCSHQAPSVEDASEESERLLKELYLFDVLRADRTTAAHGLELRVPF
LDHRLTSYYLSLPPELRIPKSGVEKHLLREAFEDANLLPKEILWRPKEAFSDGLTSLKKS
WFTILQEHVEHQVSDSALESAAQRFPLNTPKTKEGYYYRQIFEKHYPGRADWLPHYWMPK
WIEASDPSARTLTHYKSATKD
NT seq 608 nt NT seq  +upstreamnt  +downstreamnt
cgtcccccttcctccccctcagggctaatgcctggcgcctctgtgtttgctcccaccagg
cgccgtcggtggaggatgccagcgaagagagcgagaggctcctcaaggaactgtatctct
ttgacgtcctgcgtgccgaccggaccacagcggcgcacggcctcgagctgcgggtcccct
tcctggatcacagactcacttcctattacctgtccctgcccccggagctccggatcccaa
agagcggggtcgagaagcacctcctaagggaggcctttgaggacgccaacctgctgccca
aagagatcctctggaggcccaaagaggccttcagcgacgggctcacctccctcaagaagt
cctggttcaccatcctccaggagcacgtggagcatcaggtgtccgactcggcgctggaga
gcgctgcccagaggttcccactgaacactcccaagaccaaggagggctactactaccggc
agattttcgagaagcactacccgggccgtgcggactggctcccccattactggatgccca
agtggatcgaggccagcgacccctcggcccgcacgttgacgcactacaagtcggccacca
aggactag

DBGET integrated database retrieval system