KEGG   Monodelphis domestica (opossum): 100027732Help
Entry
100027732         CDS       T01031                                 

Gene name
MLYCD
Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mdo00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:mdo00410]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:mdo04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 493 aa AA seqDB search
MRGLGPGLSAQRLLRLRPRLPTRPRPRRLGGPGATLERAMDELLGRTVPQAPAYELREKT
PAPAEAQCADFMRFYGALEGASQRAELLGRLARGFGVDHGQVAEQSAGVLRLGAAVGEPG
ALLHAEDRLRYALVPRYRGLFQHISKLEGGVRFLVQLRADLLEAQALKIAEGPHVREMNG
VLKNMLSDWFSTGFLNLERVTWHSPCEVLQKISECEAVHPVKNWMDMKRRVSSYRRCYFF
SHCSTPGEPLIVLHVALTNEITNNIQTIVKEFCPPETEDKNKIVTAIFYSISLTQQGLQG
VELGSFLIKRVVKELQREFPHLETFSSLSPIPGFTKWLLGTLSSQTKELGRNELFTDSEC
NEISDIIGGPISETLKILLTSNEWVKSEKLVKVLQSPLMRLCAWYLYGEKHRGYALNPVA
NFHLQNGAVMWRINWLADLSLKGTTSSCGMMVNYRYFLEETGVNSAAYLGAKNIKASEQV
LNLVSQFQKLSKL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagaggcctggggcccggactgtcagcgcaaaggctcctgcggctccggccccggctt
cccacccggccccggccacgacgacttgggggccccggggctaccctggaacgggcaatg
gatgaactgctgggccgcactgtgcctcaggccccggcctatgaactccgagaaaaaaca
cccgccccagccgaggctcagtgcgctgacttcatgcgtttctacggtgccctggagggc
gcgagccagcgggccgagctgctgggccgcctggcgcggggcttcggcgtggaccacgga
caggtggcggagcagagcgcgggagtactgcgcctaggggcggcggtgggggagcctggc
gccctccttcacgcggaggaccggcttcgctatgcacttgtaccgcgctatcgcggtctc
ttccagcacatcagcaagctggagggtggagtgcgcttcctggtccagctgcgcgcagat
ctcctcgaggcacaagccctgaagatagccgaggggcctcacgtccgggaaatgaatgga
gtgctgaagaacatgctctcagattggttttctacaggatttttaaacctggaacgtgtt
acctggcattctccttgtgaagttctacaaaaaatcagtgagtgtgaggctgtacatcct
gtcaaaaattggatggacatgaagcgacgtgttagttcataccgaagatgctattttttt
tctcactgttcaacacccggggaaccactgattgttttgcatgtagcattgaccaatgag
attaccaacaatatccagacaatagtgaaagagttttgtcctccagaaacagaagacaaa
aacaaaattgtcactgcgattttctattctatcagtttgacccagcaaggtctacaaggt
gttgaattgggaagtttccttataaaacgagttgttaaggaattgcagagggaatttcct
caccttgaaactttttcaagtctgtcacctatacctggattcaccaaatggcttcttgga
acactgagctctcaaactaaagaacttgggaggaacgaactctttacagattctgaatgt
aacgaaatctcagatatcataggtggccccattagtgaaactctgaagatacttttaact
agcaatgagtgggtgaaatctgaaaaactggtcaaggtgttacaatcccctttgatgaga
ctctgtgcttggtatttatatggagaaaaacatcgtggttatgctctcaaccccgtggca
aactttcatctgcagaatggggcagtgatgtggcggattaattggttggcagatttgagt
ctcaaaggcactacttcatcatgtgggatgatggtcaattatcgatatttcttagaagaa
actggcgtcaacagtgctgcatacctaggagccaagaatatcaaagcttctgaacaggtt
ctaaatttagtttctcagtttcagaaacttagcaagctttaa

DBGET integrated database retrieval system