KEGG   Monodelphis domestica (opossum): 100027920Help
Entry
100027920         CDS       T01031                                 

Gene name
AURKA
Definition
(RefSeq) aurora kinase A
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100027920 (AURKA)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100027920 (AURKA)
Protein kinases [BR:mdo01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   100027920 (AURKA)
Protein phosphatases and associated proteins [BR:mdo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100027920 (AURKA)
Chromosome [BR:mdo03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100027920 (AURKA)
   Spindle formation proteins
    100027920 (AURKA)
  Sister chromatid separation proteins
   Aurora kinases
    100027920 (AURKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 402 aa AA seqDB search
MDISKENSVSGPSNKTAILLGEGPKRVPITQQISSQSRLPGSSGQAQRVLCSSNPLLVSS
QAQKNISSHKTSHAHQSQKLQQAPVIHPTSRPPSSTQNTEQSQPPVSASIPGKGETPRQK
NEETKKRQWALDDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLR
REVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPRGEVYRELQKLSKFDEQRTATYITE
LADALSYCHSKKVIHRDIKPENLLLGSDGELKIADFGWSVHAPSSRRTTLCGTLDYLPPE
MIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAETYQETYRSISKVEYKFPDFVTEGARDL
ISRLLKHNPYQRLTLKELLEHPWIIANSSKSPSSRKSKESKP
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggacatatccaaagaaaacagtgtttcaggacctagcaacaagacagcaattctgctt
ggggaaggtccaaaacgtgtgcctataactcagcagatttcttctcagagtcggttacct
gggagtagtggacaagctcagcgagtcttatgttcctcaaatcctcttctagtttcttcc
caggcacaaaagaatatctctagtcataaaacaagtcatgctcaccagtcacagaagtta
cagcaagcacctgtaattcatcctacatcaagaccaccaagtagtactcaaaacactgag
caatctcagccaccagtctctgcaagcattcctggaaagggagagacaccaaggcagaaa
aatgaggaaactaaaaaaagacagtgggcattggatgattttgaaattggtcgccctttg
ggaaaaggaaaatttggaaatgtttacttggcacgagaaaaacaaagcaagtttatcctg
gcacttaaagtgctctttaaggctcaactggagaaggcaggagttgaacatcagctgaga
cgagaagtagaaatacagtctcatcttaggcatcctaatattctgagattatatggttat
tttcatgatgccacaagagtttatctaattctagaatatgcacctcgtggagaagtctat
agagagcttcaaaagctttcaaaatttgatgaacaaagaacagctacttatatcacagaa
ctggcagatgccttatcatactgccactcaaaaaaggtgattcaccgagatattaagcca
gagaacttattacttggatcagatggagagctgaagattgcagattttggctggtcagtg
catgccccatcatctaggaggacaactctttgtggcacacttgattatctacctcctgag
atgattgagggcaggatgcatgatgaaaaggtagatctgtggagtcttggagttctgtgc
tatgaatttctagttggaaagcctccttttgaggcagaaacatatcaagaaacttacaga
agcatttcaaaggttgaatataaattccctgactttgtaacagaaggggctagggatctc
atttcaagacttttgaagcataatccttaccaaaggctaacactaaaggaactccttgaa
catccttggatcatagcgaattcttcaaaatcaccaagcagccgaaaaagcaaagaatca
aaaccttaa

DBGET integrated database retrieval system