KEGG   Monodelphis domestica (opossum): 100028029Help
Entry
100028029         CDS       T01031                                 

Gene name
CLK4
Definition
CDC-like kinase 4
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 481 aa AA seqDB search
MRHSKRTHCPDWDGRESWGHESYSSSHKRKKRSHSSTQENRHCKPHLQFKEADCHYLEVR
SLNERDYRERRYVDEYRNDYCEGYDHRHYHRDYESSYHNHCSKSSGRSRRSSPKRKRNRH
CSSHQSHSKSHRRKRSRSIEDDEEGHLICQSGDVLRARYEIVATLGEGAFGKVVECIDRD
MDDTHVAVKIVKNVGRYREAARSEIQVLEHLNSTDPNSVFRCVQMLEWFDHHGHVCIVFE
LLGLSTYDFIKENSFLPFQLDHIRQMAYQICQSINFLHHNKLTHTDLKPENILFVKSDYV
VKYNSKMKRDERTLKNTDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDV
WSIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPTHMIQKTRKRKYFHHNQLDWDEH
SSAGRYVRRRCKPLKEFMLCHDAEHENLFDLVRRMLEYDPAKRITLDEALQHPFFDLLKK
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcggcattcaaaacgaactcactgtcctgattgggatggtagggaaagctggggtcat
gaaagctacagtagcagtcacaaacgcaagaagagatcccacagtagtacgcaagagaac
aggcactgtaaaccacatctacagtttaaagaagcagattgtcattatttggaagtaaga
tccttaaatgagagagattatcgtgagcggagatatgttgatgaatacagaaatgactac
tgtgaaggatatgatcatagacattatcatagagactatgaaagcagttatcacaaccac
tgcagtaaatcttcaggccgaagcaggagaagtagtccaaaaaggaagcgtaatagacat
tgttcaagccatcaatcacattcgaagagtcaccgaaggaaaagatccaggagtatagag
gatgatgaggagggtcacctgatctgtcaaagtggagacgtactaagagcaagatatgaa
attgttgctactttgggtgaaggagcttttggcaaagtagtagagtgcattgatcgggat
atggatgatacgcatgttgcagtgaaaattgtaaaaaatgttggtagataccgtgaagct
gctcgttcagaaatccaagtattggagcatttaaacagtactgatcccaatagcgtgttc
cgatgtgtccaaatgctggagtggtttgatcatcatggtcatgtttgcattgtatttgaa
ctgctgggactcagtacttatgattttattaaagaaaatagttttttgccatttcaactt
gaccatatcaggcagatggcatatcagatctgccagtccataaattttttgcatcataat
aagttgacccatacagatctgaaacctgaaaatattttgtttgttaagtctgactatgta
gtcaagtacaattctaaaatgaaacgtgacgaacgcacactgaaaaatacagatatcaaa
gttgttgattttggaagtgcaacttatgatgatgagcatcacagcactttagtatctaca
cgacactacagagctccagaagtcattttagcactgggatggtctcagccctgtgatgtt
tggagtataggctgcattctcattgaatattatcttggtttcacagtatttcaaacacat
gatagtaaagaacacttagcaatgatggaacggatattaggacctataccaacacatatg
atccagaaaacaagaaaacgcaaatattttcaccacaatcagttggattgggatgaacat
agttcggctggtagatatgttagaagacgttgcaaaccattaaaggaatttatgctttgt
catgatgcagaacatgagaatctatttgacctggttcgaaggatgttagagtatgatcca
gccaaaagaattaccttggatgaagcattacaacatcctttctttgacttattaaaaaag
aaatga

DBGET integrated database retrieval system