KEGG   Monodelphis domestica (opossum): 100028046Help
Entry
100028046         CDS       T01031                                 

Gene name
MYL10
Definition
myosin, light chain 10, regulatory
Orthology
K12756  
myosin regulatory light chain 10
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100028046 (MYL10)
  Cellular commiunity
   04510 Focal adhesion
    100028046 (MYL10)
   04530 Tight junction
    100028046 (MYL10)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100028046 (MYL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 184 aa AA seqDB search
MCYLAGWHNRGDGKNSFMAPKKAKKRAEGGAGSNVFSMFDQSQIQEFKEAFTIMDQNRDG
FIDKNDLRDTFAALGRLNVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHA
FKIFDVEGKGVLKADFIKEKLMTQADRFSEEEIKQMFTAFPPDVRGNLDYKNLCYVITHG
EEKD
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgtgctatcttgcaggttggcacaacagaggcgacggaaagaacagcttcatggcaccc
aaaaaggcaaagaagagggcagagggaggagctggttctaatgtgttctccatgtttgac
caatcccagatccaggagtttaaagaggccttcaccatcatggatcagaatcgggatggc
ttcatcgataaaaatgacctgagagacacctttgctgccctgggtcgtctcaacgtcaag
aatgaagaattggaagccatggtgaaggaggctcctggtcccatcaacttcaccgtattc
ctgacaatgtttggtgagaagctgaagggcacagatccagaagagaccatcttgcatgct
ttcaagatttttgatgttgaaggaaaaggtgtccttaaggcagacttcatcaaagaaaag
ctcatgacccaagcagacaggttcagtgaagaagagatcaagcagatgtttacagctttc
cctccagatgtgcgcggcaatctcgactataagaacctgtgctatgtcatcacccacggg
gaagagaaagactag

DBGET integrated database retrieval system