KEGG   Monodelphis domestica (opossum): 100028046Help
Entry
100028046         CDS       T01031                                 

Definition
myosin regulatory light chain 10-like
Orthology
K12756  
myosin regulatory light chain 10
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mdo04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:mdo04510]
Cellular Processes; Cell communication; Tight junction [PATH:mdo04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:mdo04670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 287 aa AA seqDB search
MSQGQPLTNVHLQLCCWANPKSCTDEMPEILLGSGYRTFATLHLLSKLGTGIFALIVSNT
IKETIATRCAILQVGTTEATERTASWDWGIGRCQTLDVNLGTDSPAEEVPDGENEGSEVS
QAPKKAKKRAEGGAGSNVFSMFDQSQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRL
NVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKIFDVEGKGVLKADFI
KEKLMTQADRFSEEEIKQMFTAFPPDVRGNLDYKNLCYVITHGEEKD
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagggcagcccttgaccaacgttcatctccagctttgttgctgggcaaatccc
aagtcctgcacagatgagatgccagagattctcttgggctctggttaccgcacttttgcc
accttacatctattgtctaaacttggaacgggcatatttgccctcattgtcagcaacact
ataaaagagacaattgccactagatgtgctatcttgcaggttggcacaacagaggcgacg
gaaagaacagcttcatgggactggggcattgggaggtgccagactttggatgttaatctg
ggcacagatagccctgctgaggaggtcccagatggagagaatgaaggctctgaagtctca
caggcacccaaaaaggcaaagaagagggcagagggaggagctggttctaatgtgttctcc
atgtttgaccaatcccagatccaggagtttaaagaggccttcaccatcatggatcagaat
cgggatggcttcatcgataaaaatgacctgagagacacctttgctgccctgggtcgtctc
aacgtcaagaatgaagaattggaagccatggtgaaggaggctcctggtcccatcaacttc
accgtattcctgacaatgtttggtgagaagctgaagggcacagatccagaagagaccatc
ttgcatgctttcaagatttttgatgttgaaggaaaaggtgtccttaaggcagacttcatc
aaagaaaagctcatgacccaagcagacaggttcagtgaagaagagatcaagcagatgttt
acagctttccctccagatgtgcgcggcaatctcgactataagaacctgtgctatgtcatc
acccacggggaagagaaagactag

DBGET integrated database retrieval system