KEGG   Monodelphis domestica (opossum): 100028089Help
Entry
100028089         CDS       T01031                                 

Gene name
MAPK9
Definition
mitogen-activated protein kinase 9
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Osteoclast differentiation
Focal adhesion
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Salmonella infection
Pertussis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Influenza A
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Colorectal cancer
Pancreatic cancer
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:mdo04141]
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:mdo04014]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mdo04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:mdo04012]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:mdo04310]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:mdo04668]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:mdo04068]
Cellular Processes; Cell communication; Focal adhesion [PATH:mdo04510]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:mdo04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:mdo04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:mdo04622]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:mdo04664]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:mdo04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:mdo04920]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:mdo04912]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:mdo04914]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:mdo04917]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:mdo04728]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:mdo04723]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:mdo04722]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:mdo04750]
Organismal Systems; Development; Osteoclast differentiation [PATH:mdo04380]
Human Diseases; Cancers; Pathways in cancer [PATH:mdo05200]
Human Diseases; Cancers; Colorectal cancer [PATH:mdo05210]
Human Diseases; Cancers; Pancreatic cancer [PATH:mdo05212]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:mdo04930]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:mdo04932]
Human Diseases; Infectious diseases; Salmonella infection [PATH:mdo05132]
Human Diseases; Infectious diseases; Pertussis [PATH:mdo05133]
Human Diseases; Infectious diseases; Tuberculosis [PATH:mdo05152]
Human Diseases; Infectious diseases; Influenza A [PATH:mdo05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:mdo05161]
Human Diseases; Infectious diseases; Hepatitis C [PATH:mdo05160]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:mdo05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:mdo05169]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:mdo05145]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:mdo05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 424 aa AA seqDB search
MSDNKCDSHFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVVGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSSDFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKLKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVNSNTTPSQSSSINDISSMSTEQTLASDTDSSLDALTGPI
EGCR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaataaatgtgatagtcatttttatagcgtgcaagttgcagattcaactttc
acagtactcaaacgttaccagcaattaaaaccaataggatctggagctcagggaattgtt
tgtgctgcttttgatacagttgttgggataaatgttgctgtcaagaaattaagtcgacca
tttcagaatcaaactcatgcaaagagagcttatcgtgaactcgttctgttaaaatgtgtc
aatcataaaaatataattagcttattgaatgtgttcactccacaaaaatctctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaatttatgccaagtgattcat
atggaattggatcatgaaagaatgtcttaccttctttatcagatgctttgtggtattaaa
catcttcattcagctggtataatacaccgagatttgaaacccagcaacatagtagtaaag
tcagattgcacactcaagatccttgattttggcctggcacgaacagcatgtactaatttt
atgatgactccatatgtagtcacacggtattatagagcacctgaagttatcttggggatg
ggatacaaagaaaatgttgatatctggtcagtggggtgcatcatgggagaactggtgaaa
ggttgtgtgatattccaaggcactgatcatattgatcagtggaataaagttattgagcag
ttaggaacaccgtcttcagactttatgaagaaattgcaaccaactgtgaggaattatgta
gaaaacaggccaaaatatcctggtatcaaatttgaagaacttttccctgattggatattc
ccatcagaatctgaacgagataaactgaaaacaagtcaagctagagatttgttatcaaaa
atgcttgtaatagatcctgacaagcgaatttctgttgatgaagccttacgacatccttat
attactgtttggtatgatcctgctgaagcagaggcaccaccaccgcaaatttatgatgcc
cagttagaagaacgagaacatgctattgaagaatggaaagaactaatatacaaagaagta
atggactgggaagaaagaagcaagaatggtgtggtaaaagatcaaccttcagatgcagca
gtaaatagcaacaccactccttctcagtcctcatctatcaatgatatttcatccatgtca
acagagcagacattggcttcagatacagacagcagcctggatgccttgacaggacccatt
gaaggttgtcgatga

DBGET integrated database retrieval system