KEGG   Monodelphis domestica (opossum): 100028096Help
Entry
100028096         CDS       T01031                                 

Gene name
MAPK1
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo01521  EGFR tyrosine kinase inhibitor resistance
mdo01522  Endocrine resistance
mdo01524  Platinum drug resistance
mdo04010  MAPK signaling pathway
mdo04012  ErbB signaling pathway
mdo04014  Ras signaling pathway
mdo04015  Rap1 signaling pathway
mdo04022  cGMP-PKG signaling pathway
mdo04024  cAMP signaling pathway
mdo04062  Chemokine signaling pathway
mdo04066  HIF-1 signaling pathway
mdo04068  FoxO signaling pathway
mdo04071  Sphingolipid signaling pathway
mdo04072  Phospholipase D signaling pathway
mdo04114  Oocyte meiosis
mdo04140  Autophagy - animal
mdo04150  mTOR signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo04210  Apoptosis
mdo04218  Cellular senescence
mdo04261  Adrenergic signaling in cardiomyocytes
mdo04270  Vascular smooth muscle contraction
mdo04350  TGF-beta signaling pathway
mdo04360  Axon guidance
mdo04370  VEGF signaling pathway
mdo04371  Apelin signaling pathway
mdo04380  Osteoclast differentiation
mdo04510  Focal adhesion
mdo04520  Adherens junction
mdo04540  Gap junction
mdo04550  Signaling pathways regulating pluripotency of stem cells
mdo04611  Platelet activation
mdo04620  Toll-like receptor signaling pathway
mdo04621  NOD-like receptor signaling pathway
mdo04625  C-type lectin receptor signaling pathway
mdo04650  Natural killer cell mediated cytotoxicity
mdo04657  IL-17 signaling pathway
mdo04658  Th1 and Th2 cell differentiation
mdo04659  Th17 cell differentiation
mdo04660  T cell receptor signaling pathway
mdo04662  B cell receptor signaling pathway
mdo04664  Fc epsilon RI signaling pathway
mdo04666  Fc gamma R-mediated phagocytosis
mdo04668  TNF signaling pathway
mdo04713  Circadian entrainment
mdo04720  Long-term potentiation
mdo04722  Neurotrophin signaling pathway
mdo04723  Retrograde endocannabinoid signaling
mdo04724  Glutamatergic synapse
mdo04725  Cholinergic synapse
mdo04726  Serotonergic synapse
mdo04730  Long-term depression
mdo04810  Regulation of actin cytoskeleton
mdo04910  Insulin signaling pathway
mdo04912  GnRH signaling pathway
mdo04914  Progesterone-mediated oocyte maturation
mdo04915  Estrogen signaling pathway
mdo04916  Melanogenesis
mdo04917  Prolactin signaling pathway
mdo04919  Thyroid hormone signaling pathway
mdo04921  Oxytocin signaling pathway
mdo04926  Relaxin signaling pathway
mdo04928  Parathyroid hormone synthesis, secretion and action
mdo04930  Type II diabetes mellitus
mdo04933  AGE-RAGE signaling pathway in diabetic complications
mdo04934  Cushing's syndrome
mdo04960  Aldosterone-regulated sodium reabsorption
mdo05010  Alzheimer's disease
mdo05020  Prion diseases
mdo05034  Alcoholism
mdo05132  Salmonella infection
mdo05133  Pertussis
mdo05140  Leishmaniasis
mdo05142  Chagas disease (American trypanosomiasis)
mdo05145  Toxoplasmosis
mdo05152  Tuberculosis
mdo05160  Hepatitis C
mdo05161  Hepatitis B
mdo05164  Influenza A
mdo05165  Human papillomavirus infection
mdo05167  Kaposi's sarcoma-associated herpesvirus infection
mdo05200  Pathways in cancer
mdo05203  Viral carcinogenesis
mdo05205  Proteoglycans in cancer
mdo05210  Colorectal cancer
mdo05211  Renal cell carcinoma
mdo05212  Pancreatic cancer
mdo05213  Endometrial cancer
mdo05214  Glioma
mdo05215  Prostate cancer
mdo05216  Thyroid cancer
mdo05218  Melanoma
mdo05219  Bladder cancer
mdo05220  Chronic myeloid leukemia
mdo05221  Acute myeloid leukemia
mdo05223  Non-small cell lung cancer
mdo05224  Breast cancer
mdo05225  Hepatocellular carcinoma
mdo05226  Gastric cancer
mdo05230  Central carbon metabolism in cancer
mdo05231  Choline metabolism in cancer
Module
mdo_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100028096 (MAPK1)
   04015 Rap1 signaling pathway
    100028096 (MAPK1)
   04010 MAPK signaling pathway
    100028096 (MAPK1)
   04012 ErbB signaling pathway
    100028096 (MAPK1)
   04350 TGF-beta signaling pathway
    100028096 (MAPK1)
   04370 VEGF signaling pathway
    100028096 (MAPK1)
   04371 Apelin signaling pathway
    100028096 (MAPK1)
   04668 TNF signaling pathway
    100028096 (MAPK1)
   04066 HIF-1 signaling pathway
    100028096 (MAPK1)
   04068 FoxO signaling pathway
    100028096 (MAPK1)
   04072 Phospholipase D signaling pathway
    100028096 (MAPK1)
   04071 Sphingolipid signaling pathway
    100028096 (MAPK1)
   04024 cAMP signaling pathway
    100028096 (MAPK1)
   04022 cGMP - PKG signaling pathway
    100028096 (MAPK1)
   04151 PI3K-Akt signaling pathway
    100028096 (MAPK1)
   04150 mTOR signaling pathway
    100028096 (MAPK1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100028096 (MAPK1)
  Cell growth and death
   04114 Oocyte meiosis
    100028096 (MAPK1)
   04210 Apoptosis
    100028096 (MAPK1)
   04218 Cellular senescence
    100028096 (MAPK1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100028096 (MAPK1)
   04520 Adherens junction
    100028096 (MAPK1)
   04540 Gap junction
    100028096 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100028096 (MAPK1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100028096 (MAPK1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100028096 (MAPK1)
   04620 Toll-like receptor signaling pathway
    100028096 (MAPK1)
   04621 NOD-like receptor signaling pathway
    100028096 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    100028096 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    100028096 (MAPK1)
   04660 T cell receptor signaling pathway
    100028096 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    100028096 (MAPK1)
   04659 Th17 cell differentiation
    100028096 (MAPK1)
   04657 IL-17 signaling pathway
    100028096 (MAPK1)
   04662 B cell receptor signaling pathway
    100028096 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    100028096 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    100028096 (MAPK1)
   04062 Chemokine signaling pathway
    100028096 (MAPK1)
  Endocrine system
   04910 Insulin signaling pathway
    100028096 (MAPK1)
   04912 GnRH signaling pathway
    100028096 (MAPK1)
   04915 Estrogen signaling pathway
    100028096 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    100028096 (MAPK1)
   04917 Prolactin signaling pathway
    100028096 (MAPK1)
   04921 Oxytocin signaling pathway
    100028096 (MAPK1)
   04926 Relaxin signaling pathway
    100028096 (MAPK1)
   04919 Thyroid hormone signaling pathway
    100028096 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    100028096 (MAPK1)
   04916 Melanogenesis
    100028096 (MAPK1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100028096 (MAPK1)
   04270 Vascular smooth muscle contraction
    100028096 (MAPK1)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100028096 (MAPK1)
  Nervous system
   04724 Glutamatergic synapse
    100028096 (MAPK1)
   04725 Cholinergic synapse
    100028096 (MAPK1)
   04726 Serotonergic synapse
    100028096 (MAPK1)
   04720 Long-term potentiation
    100028096 (MAPK1)
   04730 Long-term depression
    100028096 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    100028096 (MAPK1)
   04722 Neurotrophin signaling pathway
    100028096 (MAPK1)
  Development
   04360 Axon guidance
    100028096 (MAPK1)
   04380 Osteoclast differentiation
    100028096 (MAPK1)
  Environmental adaptation
   04713 Circadian entrainment
    100028096 (MAPK1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100028096 (MAPK1)
   05230 Central carbon metabolism in cancer
    100028096 (MAPK1)
   05231 Choline metabolism in cancer
    100028096 (MAPK1)
   05205 Proteoglycans in cancer
    100028096 (MAPK1)
   05203 Viral carcinogenesis
    100028096 (MAPK1)
   05210 Colorectal cancer
    100028096 (MAPK1)
   05212 Pancreatic cancer
    100028096 (MAPK1)
   05225 Hepatocellular carcinoma
    100028096 (MAPK1)
   05226 Gastric cancer
    100028096 (MAPK1)
   05214 Glioma
    100028096 (MAPK1)
   05216 Thyroid cancer
    100028096 (MAPK1)
   05221 Acute myeloid leukemia
    100028096 (MAPK1)
   05220 Chronic myeloid leukemia
    100028096 (MAPK1)
   05218 Melanoma
    100028096 (MAPK1)
   05211 Renal cell carcinoma
    100028096 (MAPK1)
   05219 Bladder cancer
    100028096 (MAPK1)
   05215 Prostate cancer
    100028096 (MAPK1)
   05213 Endometrial cancer
    100028096 (MAPK1)
   05224 Breast cancer
    100028096 (MAPK1)
   05223 Non-small cell lung cancer
    100028096 (MAPK1)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100028096 (MAPK1)
   05020 Prion diseases
    100028096 (MAPK1)
  Substance dependence
   05034 Alcoholism
    100028096 (MAPK1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100028096 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100028096 (MAPK1)
   04934 Cushing's syndrome
    100028096 (MAPK1)
  Infectious diseases
   05132 Salmonella infection
    100028096 (MAPK1)
   05133 Pertussis
    100028096 (MAPK1)
   05152 Tuberculosis
    100028096 (MAPK1)
   05164 Influenza A
    100028096 (MAPK1)
   05161 Hepatitis B
    100028096 (MAPK1)
   05160 Hepatitis C
    100028096 (MAPK1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100028096 (MAPK1)
   05165 Human papillomavirus infection
    100028096 (MAPK1)
   05145 Toxoplasmosis
    100028096 (MAPK1)
   05140 Leishmaniasis
    100028096 (MAPK1)
   05142 Chagas disease (American trypanosomiasis)
    100028096 (MAPK1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100028096 (MAPK1)
   01524 Platinum drug resistance
    100028096 (MAPK1)
   01522 Endocrine resistance
    100028096 (MAPK1)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100028096 (MAPK1)
Protein kinases [BR:mdo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100028096 (MAPK1)
Chromosome and associated proteins [BR:mdo03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100028096 (MAPK1)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100028096 (MAPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase Kinase-like FTA2 Choline_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 100028096
NCBI-ProteinID: XP_001378209
Ensembl: ENSMODG00000017722
UniProt: F7FHD1
Position
3
AA seq 359 aa AA seqDB search
MAAGGGGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEH
QTYCQRTLREIKILLRFRHENIIGINDIIRAPAIEQMKDVYIVQDLMETDLYKLLKTQHL
SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHT
GFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHIL
GILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADPKALDLLDKMLTFNPHKR
IEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaggaggcggcggcgcgggtcccgagatggtccgcgggcaggtgttcgacgtg
ggcccacgctacaccaatctctcgtacatcggcgagggagcctatggcatggtgtgttct
gcgtatgacaacgtcaacaaggtccgcgtggccatcaagaaaatcagcccctttgagcac
cagacctactgccagcggaccctgcgcgaaatcaagattttgctgcgcttccgccacgag
aatatcatcggcatcaacgatatcattcgggcaccagccatcgagcagatgaaagatgta
tatatcgtacaggaccttatggaaacggacctttacaagctcttgaagacgcaacacctc
agcaatgaccacatctgttatttcctttaccagatcctcagaggtttaaaatacatccat
tcagccaacgttctgcaccgtgacctcaaaccttctaacttactgctcaacaccacctgc
gatctcaagatctgtgactttggcctggcacgtgttgcagatccagaccatgaccacaca
ggcttcctgacagaatatgtggccacacgctggtaccgagcacctgaaatcatgctgaat
tccaagggttacaccaagtccattgacatctggtctgtgggctgtattctggctgagatg
ctctccaacaggcccattttccctggaaagcattaccttgatcagctgaaccacattctc
ggcattcttgggtctccttcacaagaagacttgaattgcataataaatctaaaagccagg
aactatttactgtctcttcctcacaaaaacaaggtgccgtggaatagactcttccccaat
gccgaccccaaagccctggacttactggataagatgttgacgttcaaccctcacaagagg
atcgaagtggagcaggcgctggcccacccctacctggagcagtattacgaccccagtgac
gagcctgtggccgaagccccgttcaagtttgacatggagctggacgacctgcccaaggag
aagctgaaggagctgatttttgaagagactgctagattccagcccggataccgatcttaa

DBGET integrated database retrieval system