KEGG   Monodelphis domestica (opossum): 100028122Help
Entry
100028122         CDS       T01031                                 

Gene name
ECHS1
Definition
enoyl CoA hydratase, short chain, 1, mitochondrial
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100028122 (ECHS1)
   01212 Fatty acid metabolism
    100028122 (ECHS1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100028122 (ECHS1)
   00650 Butanoate metabolism
    100028122 (ECHS1)
  Lipid metabolism
   00062 Fatty acid elongation
    100028122 (ECHS1)
   00071 Fatty acid degradation
    100028122 (ECHS1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100028122 (ECHS1)
   00310 Lysine degradation
    100028122 (ECHS1)
   00380 Tryptophan metabolism
    100028122 (ECHS1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100028122 (ECHS1)
Enzymes [BR:mdo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100028122 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 290 aa AA seqDB search
MASLSTLLFRGPALLRSCPRLSAARNYAAGGNFEYIVTEKKGKNNNVGLIQLNRPKALNA
LCEGLIKEINQALMTFQEDPSIGAIVLTGSEKAFAAGADIKEMQDKTFQACYSGTLLKDW
DRITQLKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILIGTIPGAGGTQRLT
RIVGKSLAMEMVLTGDRISAQEAKQAGLISKIFPVDKLVEEAILCAEKIANNSKIVTEMA
KESVNAAYETTLAEGIKMEKKLFYSTFATEDRKEGMTAFVEKRKPNFKDK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcctctctgtccacgctgctgttccgtgggcccgccctgctccgcagctgcccccgg
ctgtccgcggcccgcaactacgctgcgggtggtaactttgaatacatagttactgaaaag
aaagggaagaataataatgtgggtctgatccagctgaacaggccaaaggccctgaatgca
ctttgtgagggcctgattaaggagatcaaccaggccctgatgacatttcaagaggatcca
tctataggagccattgtcctgacgggttcagaaaaggcatttgcagctggagcagatatc
aaggaaatgcaggataaaactttccaggcttgttactcagggacattattaaaggactgg
gaccggatcacccagctcaagaagccagtaatagctgccgtcaatggctacgcacttgga
ggaggttgtgagcttgctatgatgtgtgacatcatctatgctggtgagaaagctcaattt
ggacagccagagatcctaataggaaccatcccaggtgctgggggaactcagagacttacc
cgaatagttggaaagtccttggcaatggagatggttcttacaggtgaccgaatctcagct
caagaagccaagcaagcaggcctcatcagcaaaattttccctgtggataagctggttgaa
gaagccatcctgtgtgcagaaaaaattgccaacaattcaaaaattgtgacagaaatggcc
aaagaatccgtgaacgcagcttatgagacgacattagcagaaggaattaaaatggagaag
aaactcttctactcaacttttgccactgaggatcggaaagagggaatgactgcatttgtg
gagaagaggaagcccaacttcaaggacaaataa

DBGET integrated database retrieval system