KEGG   Monodelphis domestica (opossum): 100028615Help
Entry
100028615         CDS       T01031                                 

Gene name
GLB1
Definition
galactosidase, beta 1
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100028615 (GLB1)
  Lipid metabolism
   00600 Sphingolipid metabolism
    100028615 (GLB1)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100028615 (GLB1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    100028615 (GLB1)
   00511 Other glycan degradation
    100028615 (GLB1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100028615 (GLB1)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     100028615 (GLB1)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100028615 (GLB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 640 aa AA seqDB search
MMPGQALWCLLLLQPLLTTVELTLQTNRTFQIDYERDQFLKDGKPFRYISGSIHYSRIPR
FYWKDRLLKMKMAGLNAIQTYVPWNFHEPLPGVYRFSDDYDLEYFLQLAHEIGLLVILRP
GPYICAEWDMGGLPAWLLTKKSIVLRSSDPDYLAETEKWLGVLLPKMKPYLYQNGGPIIT
VQVENEYGSYFTCDYNYLRFLQQLFHKHLGEEVVLFTTDGASEDYLKCGTLQGLYATVDF
GTNHNITEAFQSQRKTEPKGPLVNSEFYTGWLDHWGEAHETVDTKAIISSLNDMLSQGAN
VNMYMFIGGTNFGFWNGANIPYAAQPTSYDYDAPLSEAGDLTEKYFALRELIGKFEKLPE
GLIPPTTPKFAYGKVAMKKVNTLEESLDVLCPEGPINSTYPLTFIEVKQYFGFVLYRTTL
PKNCSEPVPLSSPLNGVHDRAYVSVNGVPQGVLERNKVISINITGKAGDILDVLVENLGR
INYGHDINDFKGLISNLTLGSVMLKDWSMFPLNLDAAVQNNLESHETWSNNPSSPSLPTF
YVGQFSIPTGIPDLPQDTFIQFPNWNKGQVWINGFNLGRYWPARGPQVTLYVPRHILVTS
SPNNITVLELEKSPCEDPRKCFVEMVDTPVLNVLPSSKKS
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctggccaggcgctctggtgtttgctgctcctgcagccactgttgacaaccgtg
gagctcacactgcagaccaacagaacatttcagatagactatgagagggaccagtttctc
aaggatggcaagccatttcgctacatctctgggagcatccattactccagaatacctcga
ttctattggaaagatcgcctactcaagatgaagatggcagggcttaatgccatccaaaca
tatgtgccttggaacttccatgagccccttcccggagtgtatcggttctctgatgattac
gatttggagtatttcctccagcttgctcatgagattggactattagttatcctgaggcca
ggaccatacatctgtgcagagtgggacatgggtggcttacctgcttggcttttgacaaaa
aagtcaattgttctccgttcttctgatcccgattaccttgcagagactgagaagtggttg
ggagtccttctgcccaagatgaagccttatctctatcaaaatggagggccaattataaca
gtccaggttgaaaatgaatatggaagctactttacttgtgattataactaccttcgtttt
ctccaacaactcttccacaaacaccttggggaagaagtggttctcttcactactgacggc
gccagtgaggattacttaaagtgtgggactctgcagggtctctatgctacggtggacttt
ggaacaaatcataacattacagaagcctttcagtcccagaggaagaccgaacccaaagga
cccttggtcaattcagagttctacactggatggttagaccactggggtgaagctcacgaa
acagtggataccaaagctatcatctcttctctcaatgacatgctttctcaaggtgctaat
gttaacatgtatatgttcatcggtgggaccaattttggcttctggaatggagccaatata
ccttacgcagcacagcctaccagctatgactatgatgccccattgagtgaagcaggagac
ctcacagagaaatactttgctctgagagaacttattggaaagtttgaaaaactaccagaa
ggacttattcctccaacaacccccaagtttgcctatggaaaagttgctatgaagaaggta
aatacactggaagagtctcttgatgttttgtgtcctgaagggccaataaatagcacttat
cccttgacatttatcgaagtgaaacagtattttggattcgtgctctacagaacaacactt
cctaaaaactgcagtgaaccagtgcccctttcttcacccctcaatggagtccatgaccga
gcctatgtttctgtgaatggggtcccccaaggagttcttgagagaaataaggtgatctcc
ataaatataactggaaaagctggtgacattctggatgtgcttgtagaaaacctggggaga
atcaactatggacacgacatcaatgactttaagggtttgatttccaatttaacccttggg
tcagttatgctcaaagactggtcaatgttcccactgaatttggatgctgcagtgcagaat
aatttggagagccatgaaacttggagcaataatccttccagcccgtctctcccaactttt
tatgttggtcagttttctattcctactggaattccagacttgcctcaggacacctttatc
cagtttcccaattggaacaagggacaggtatggatcaatggctttaatcttggacgctac
tggccagcccgtggccctcaggtcactctctatgtcccaagacacatacttgttacatct
tccccaaacaacatcactgtgttggaactagagaaatctccctgtgaagatccccgcaag
tgttttgtggagatggtggacacgcctgtgctcaacgtccttccatcttcaaagaagtcc
tag

DBGET integrated database retrieval system