KEGG   Monodelphis domestica (opossum): 100028615Help
Entry
100028615         CDS       T01031                                 

Definition
beta-galactosidase-like
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mdo00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:mdo00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:mdo00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:mdo00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:mdo00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:mdo04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 658 aa AA seqDB search
MLGGLYSRVVLYSWISDIHYRGGLGMGSTGPGHLIRNGGPNFLTNRTFQIDYERDQFLKD
GKPFRYISGSIHYSRIPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPLPGVYRFSDDYDL
EYFLQLAHEIGLLVILRPGPYICAEWDMGGLPAWLLTKKSIVLRSSDPDYLAETEKWLGV
LLPKMKPYLYQNGGPIITVQVENEYGSYFTCDYNYLRFLQQLFHKHLGEEVVLFTTDGAS
EDYLKCGTLQGLYATVDFGTNHNITEAFQSQRKTEPKGPLVNSEFYTGWLDHWGEAHETV
DTKAIISSLNDMLSQGANVNMYMFIGGTNFGFWNGANIPYAAQPTSYDYDAPLSEAGDLT
EKYFALRELIGKFEKLPEGLIPPTTPKFAYGKVAMKKVNTLEESLDVLCPEGPINSTYPL
TFIEVKQYFGFVLYRTTLPKNCSEPVPLSSPLNGVHDRAYVSVNGVPQGVLERNKVISIN
ITGKAGDILDVLVENLGRINYGHDINDFKGLISNLTLGSVMLKDWSMFPLNLDAAVQNNL
ESHETWSNNPSSPSLPTFYVGQFSIPTGIPDLPQDTFIQFPNWNKGQVWINGFNLGRYWP
ARGPQVTLYVPRHILVTSSPNNITVLELEKSPCEDPRKCFVEMVDTPVLNVLPSSKKS
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgctgggtgggctatatagccgggtggtcctctatagctggatatctgatatccattac
agaggtggcttaggcatgggctccactggccctgggcatctcattaggaatggaggaccg
aactttctgaccaacagaacatttcagatagactatgagagggaccagtttctcaaggat
ggcaagccatttcgctacatctctgggagcatccattactccagaatacctcgattctat
tggaaagatcgcctactcaagatgaagatggcagggcttaatgccatccaaacatatgtg
ccttggaacttccatgagccccttcccggagtgtatcggttctctgatgattacgatttg
gagtatttcctccagcttgctcatgagattggactattagttatcctgaggccaggacca
tacatctgtgcagagtgggacatgggtggcttacctgcttggcttttgacaaaaaagtca
attgttctccgttcttctgatcccgattaccttgcagagactgagaagtggttgggagtc
cttctgcccaagatgaagccttatctctatcaaaatggagggccaattataacagtccag
gttgaaaatgaatatggaagctactttacttgtgattataactaccttcgttttctccaa
caactcttccacaaacaccttggggaagaagtggttctcttcactactgacggcgccagt
gaggattacttaaagtgtgggactctgcagggtctctatgctacggtggactttggaaca
aatcataacattacagaagcctttcagtcccagaggaagaccgaacccaaaggacccttg
gtcaattcagagttctacactggatggttagaccactggggtgaagctcacgaaacagtg
gataccaaagctatcatctcttctctcaatgacatgctttctcaaggtgctaatgttaac
atgtatatgttcatcggtgggaccaattttggcttctggaatggagccaatataccttac
gcagcacagcctaccagctatgactatgatgccccattgagtgaagcaggagacctcaca
gagaaatactttgctctgagagaacttattggaaagtttgaaaaactaccagaaggactt
attcctccaacaacccccaagtttgcctatggaaaagttgctatgaagaaggtaaataca
ctggaagagtctcttgatgttttgtgtcctgaagggccaataaatagcacttatcccttg
acatttatcgaagtgaaacagtattttggattcgtgctctacagaacaacacttcctaaa
aactgcagtgaaccagtgcccctttcttcacccctcaatggagtccatgaccgagcctat
gtttctgtgaatggggtcccccaaggagttcttgagagaaataaggtgatctccataaat
ataactggaaaagctggtgacattctggatgtgcttgtagaaaacctggggagaatcaac
tatggacacgacatcaatgactttaagggtttgatttccaatttaacccttgggtcagtt
atgctcaaagactggtcaatgttcccactgaatttggatgctgcagtgcagaataatttg
gagagccatgaaacttggagcaataatccttccagcccgtctctcccaactttttatgtt
ggtcagttttctattcctactggaattccagacttgcctcaggacacctttatccagttt
cccaattggaacaagggacaggtatggatcaatggctttaatcttggacgctactggcca
gcccgtggccctcaggtcactctctatgtcccaagacacatacttgttacatcttcccca
aacaacatcactgtgttggaactagagaaatctccctgtgaagatccccgcaagtgtttt
gtggagatggtggacacgcctgtgctcaacgtccttccatcttcaaagaagtcctag

DBGET integrated database retrieval system