KEGG   Monodelphis domestica (opossum): 100028891Help
Entry
100028891         CDS       T01031                                 

Gene name
CYSLTR2
Definition
cysteinyl leukotriene receptor 2
Orthology
K04323  
cysteinyl leukotriene receptor 2
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100028891 (CYSLTR2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100028891 (CYSLTR2)
G protein-coupled receptors [BR:mdo04030]
 Class A. Rhodopsin family
  Other
   Cysteinyl leukotriene
    100028891 (CYSLTR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 313 aa AA seqDB search
MEPNRSFRGTWENCTVDSFKRTFYPGVYLVVFVVGVLGNGFSIFIFLLPSKKPKSVNVFM
LNLAISDFLFVCTLPFRADYYLRGSHWVFGDLACRIMSYSFYVNMYISIYFLTVLSILRF
LATVCPFRLLHITSLRTAWILCLIIWVSIMASSVSLLSSGSTHNGQQEVCLELSVYKLTK
LRILNYVVLGVGFVLPFCTLSICYMLMIKTLLKVKFPESTARMSHKKALVTVAIAQLLFL
LCFLPYHILRTLHLIQWKENECNEVLHKAVIVTVALAASNSCLNPLLYYFAGENFKQRLK
VVFKRGCLLEQTH
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggagccaaaccgcagcttcaggggcacgtgggagaattgcacggtggacagcttcaag
agaactttttaccctggggtctatttggttgtatttgtggtgggggtcttgggaaatggc
ttttccatcttcattttcctgctgccttctaaaaaacccaagtcggtgaacgtgttcatg
ctgaacttggccatttcagacttcctgtttgtgtgcacactgcccttccgagcagattat
tacctgagaggttctcactgggtgttcggggacctagcctgcaggatcatgtcctactcc
ttttatgtcaacatgtacatcagtatttacttcctgactgtgctgagcatcttgcgcttt
ctcgctacggtgtgtcccttccggctcttgcacataactagcctcaggacagcctggatc
ctgtgcttgatcatttgggtctccatcatggcctcttctgtcagccttctgagtagcggc
tcgacccacaatggccagcaggaggtgtgcttagagctgagcgtttacaaactcaccaag
ttgaggatcctgaactacgtggtgctgggcgtcggctttgtcctgcctttctgcacgctg
agcatttgctacatgctgatgatcaagactctgctcaaggtcaagttcccagagtccact
gcgcgcatgtctcacaagaaggctctggtcaccgtggctattgcccagcttctcttcctg
ctgtgtttcctgccctaccacatcctgaggacgcttcacctaatccagtggaaggagaac
gagtgcaatgaggtgctacacaaggctgtcattgtcaccgtggccctggctgcgtctaac
tcttgccttaaccctctgctctattactttgctggagagaattttaaacagagactcaaa
gtggtgttcaaaaggggatgtttactggaacaaacacactag

DBGET integrated database retrieval system