KEGG   Monodelphis domestica (opossum): 100028924Help
Entry
100028924         CDS       T01031                                 

Gene name
USP21
Definition
(RefSeq) ubiquitin specific peptidase 21
  KO
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100028924 (USP21)
Peptidases [BR:mdo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100028924 (USP21)
Ubiquitin system [BR:mdo04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100028924 (USP21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 564 aa AA seqDB search
MPQASEHRLGRAREQPISVQPRVGTKLPIGSRARSKERRSPVPAPNPMLRPLPPRPGPPE
ERFKKLELGRGRNSAPRPRGPLRADHGVPLPGSPPPAVALPLPSRTNLARSKSVSSGDLR
PVGALGGHRGCGELGAALSRLTLRPEPPVLRRSTSLRRLGGFAGPPTLITIRSEPPPTHG
PFLTSARPLESVHSDDKMAHHTLLLGSGHVGLRNLGNTCFLNAVLQCLSSTRPLRDFCLR
RDFRLEVPSGGRTQQELTEAFADVLGALWHPDSCEAVNPTRFRTVFQKYVPSFSGYSQQD
AQEFLKLLMERLHLEINRRGRRAPPILTDTPAPSLPRRGGALLEEPELSDDDQANLMWKR
YLDREDSKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKKGFAGGKVSLRDCFS
LFTKEEELESENAPVCDRCRQRTRSTKKLTVQRFPRILVLHLNRFSASRGSIKKSSVGVD
FPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRGQTGWHVYNDSRVSPVS
ENQVASSEGYVLFYQLMQEPARCL
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgccccaggcctcggagcaccgactgggccgggcccgtgaacaacccatcagtgtccag
ccccgggtgggaaccaagctacccatcggctcccgggccaggagcaaggagcgccgaagc
ccagtacctgcgcctaaccccatgctaaggccactgccccctcggcctggaccccctgag
gaaaggttcaagaagctggagctggggcgggggagaaactcagcccctcgtcccaggggc
cctctccgggctgatcatggagtgcctctgcctggctcaccacctcctgctgtggcgctg
cccctgccttcccgtactaacctggctcggtccaagtctgtgagcagcggggatttgcgg
ccagtaggggctttaggtggacatcgaggctgcggggagcttggggctgcgctgagccgc
ctaactctccggccagagcccccagtgctgaggcgcagcacctcacttcgtcgactgggt
ggcttcgctggtccccccaccctgataaccattcggtcagagccccctcccacccatggc
ccctttctcacctccgccaggcccctggagtctgtccactccgatgacaaaatggctcat
cacacgcttctcttggggtctggccatgttgggctccggaacctgggtaatacgtgcttc
ctgaatgctgtgttacagtgtctcagcagtacacggcctcttcgggacttctgtcttcgc
agagactttcggttagaggtgcctagtggaggccggacccagcaagaacttactgaagcc
tttgcagatgtgctgggagctctgtggcaccctgactcctgtgaagctgtgaaccctaca
cgtttccgcactgtcttccagaaatatgtcccttccttctccggatacagccagcaggat
gcccaggagttcctgaagctcctcatggagcggctacatctagagatcaaccggaggggc
cgccgtgcccctcccatcttgactgataccccagccccctctctacccagacgagggggg
gccctgcttgaagagcctgagctgagtgatgatgatcaagccaatctaatgtggaaacgt
tacttggatcgagaggacagcaaaatcgtggacctgtttgttggccagttgaaaagttgc
ctcaagtgccaggcctgtgggtatagatctacaacctttgaggttttctgtgatctgtcc
ctgcccatccctaagaaagggtttgctggggggaaggtgtctctgagggattgttttagc
ctcttcaccaaggaggaagaattggagtcagagaatgccccggtgtgtgacagatgtcgg
cagagaactcggagcaccaaaaaactaactgtgcagagatttccccggatccttgtgctt
cacctgaatcggttttctgcatctagaggctccattaaaaaaagttctgttggtgttgac
ttccccctgcagcgactgagcctaggggactttgccagtgataaagctgggagtccagtg
taccagctatatgccctttgcaaccattcaggcagcgtccactatggtcactacacagcc
ctgtgtcggggccagactggttggcatgtctacaatgactctcgtgtctcccccgtcagt
gaaaaccaggtggcctccagtgagggctacgtgctgttttaccagttgatgcaggagcca
gctcgatgcctgtga

DBGET integrated database retrieval system