KEGG   Monodelphis domestica (opossum): 100029138Help
Entry
100029138         CDS       T01031                                 

Gene name
GCH1
Definition
(RefSeq) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00790  Folate biosynthesis
mdo01100  Metabolic pathways
Module
mdo_M00842  Tetrahydrobiopterin biosynthesis, GTP => BH4
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100029138 (GCH1)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     100029138 (GCH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydroI QueF MAPKK1_Int
Motif
Other DBs
NCBI-GeneID: 100029138
NCBI-ProteinID: XP_001378968
Ensembl: ENSMODG00000011684
UniProt: F7GE69
Position
1
AA seq 355 aa AA seqDB search
MTHGEALANGNHALLGLYKEVDAAKAHLSDTRGCVHRAAHTNTHRGSCSRRGKHSNPGNL
KRAENSPGKFGDSTPSSLAMEGVPISPRAERRPLRAPAPLLPTRQIEKTGTARTPAEKRR
GAQCNGYAAKEQPGPERSEREEKPRGLEEKSAQPVDFWKTERTRSVEDNELNLPSLAGAY
STILRSLGEDPERQGLLKTPWRAATAMQFFTKGYQETISDILNDAIFDEDHDEMVIVKDI
DMFSMCEHHLVPFVGKVHIGYLPNKQLLGLSKLARIVEIYSRRLQVQERLTKQIAVAVTE
ALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIKN
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacggggaagctctggctaatgggaatcatgccctcctcgggctctataaagag
gtggacgctgcaaaggcacacttgtcggatactcgcgggtgcgtacacagagctgcgcac
acaaacacacacagaggctcgtgttcacgccggggcaagcattcgaacccagggaacctt
aagcgtgcggaaaattctcctggcaagttcggtgacagcactcccagttcattggccatg
gaaggcgtcccaatttcccctagagctgaacgacggccgctacgggctccagccccactt
cttcccactaggcagatagagaaaacaggcactgctcgcacaccggcggagaagcggaga
ggtgcccagtgcaatgggtacgctgcgaaggagcaacccgggccagagcggagcgagcgc
gaggaaaagcctaggggcctggaggaaaagagcgcccagccggtggacttttggaagacg
gagaggactcgcagcgtggaggataatgagctgaatctgcccagcctagcgggcgcttac
tccaccatcctgcgctctctgggggaggacccagagaggcagggactactcaagacaccc
tggagggcggcaacagccatgcagttcttcactaagggctaccaggagaccatttcagat
atcctgaatgatgccatatttgatgaagaccatgatgagatggtgattgtaaaggacata
gacatgttttcaatgtgtgagcatcacttagtgccatttgttggaaaggttcatataggt
tatcttcctaacaaacaactccttggcctcagcaaacttgccaggattgtggaaatctat
agtaggagattacaagttcaagagcgtcttacaaaacaaattgcagtagcagtcacagag
gccctgcggccagctggagttggagtggttgttgaagcaacacacatgtgcatggtaatg
cgaggggtacagaaaatgaacagcaaaacagtcaccagcacaatgttgggtgtatttcgg
gaagatccaaagacccgggaagaattcttaacactcattaagaactga

DBGET integrated database retrieval system