KEGG   Monodelphis domestica (opossum): 100029138Help
Entry
100029138         CDS       T01031                                 

Gene name
GCH1
Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100029138 (GCH1)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     100029138 (GCH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 355 aa AA seqDB search
MTHGEALANGNHALLGLYKEVDAAKAHLSDTRGCVHRAAHTNTHRGSCSRRGKHSNPGNL
KRAENSPGKFGDSTPSSLAMEGVPISPRAERRPLRAPAPLLPTRQIEKTGTARTPAEKRR
GAQCNGYAAKEQPGPERSEREEKPRGLEEKSAQPVDFWKTERTRSVEDNELNLPSLAGAY
STILRSLGEDPERQGLLKTPWRAATAMQFFTKGYQETISDILNDAIFDEDHDEMVIVKDI
DMFSMCEHHLVPFVGKVHIGYLPNKQLLGLSKLARIVEIYSRRLQVQERLTKQIAVAVTE
ALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIKN
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacggggaagctctggctaatgggaatcatgccctcctcgggctctataaagag
gtggacgctgcaaaggcacacttgtcggatactcgcgggtgcgtacacagagctgcgcac
acaaacacacacagaggctcgtgttcacgccggggcaagcattcgaacccagggaacctt
aagcgtgcggaaaattctcctggcaagttcggtgacagcactcccagttcattggccatg
gaaggcgtcccaatttcccctagagctgaacgacggccgctacgggctccagccccactt
cttcccactaggcagatagagaaaacaggcactgctcgcacaccggcggagaagcggaga
ggtgcccagtgcaatgggtacgctgcgaaggagcaacccgggccagagcggagcgagcgc
gaggaaaagcctaggggcctggaggaaaagagcgcccagccggtggacttttggaagacg
gagaggactcgcagcgtggaggataatgagctgaatctgcccagcctagcgggcgcttac
tccaccatcctgcgctctctgggggaggacccagagaggcagggactactcaagacaccc
tggagggcggcaacagccatgcagttcttcactaagggctaccaggagaccatttcagat
atcctgaatgatgccatatttgatgaagaccatgatgagatggtgattgtaaaggacata
gacatgttttcaatgtgtgagcatcacttagtgccatttgttggaaaggttcatataggt
tatcttcctaacaaacaactccttggcctcagcaaacttgccaggattgtggaaatctat
agtaggagattacaagttcaagagcgtcttacaaaacaaattgcagtagcagtcacagag
gccctgcggccagctggagttggagtggttgttgaagcaacacacatgtgcatggtaatg
cgaggggtacagaaaatgaacagcaaaacagtcaccagcacaatgttgggtgtatttcgg
gaagatccaaagacccgggaagaattcttaacactcattaagaactga

DBGET integrated database retrieval system