KEGG   Monodelphis domestica (opossum): 100029287Help
Entry
100029287         CDS       T01031                                 

Gene name
CLTCL1
Definition
(RefSeq) clathrin heavy chain like 1
  KO
K04646  
clathrin heavy chain
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100029287 (CLTCL1)
   04142 Lysosome
    100029287 (CLTCL1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100029287 (CLTCL1)
  Nervous system
   04721 Synaptic vesicle cycle
    100029287 (CLTCL1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100029287 (CLTCL1)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100029287 (CLTCL1)
Membrane trafficking [BR:mdo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    100029287 (CLTCL1)
Exosome [BR:mdo04147]
 Exosomal proteins
  Proteins found in most exosomes
   100029287 (CLTCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 1741 aa AA seqDB search
MAQILPIRFQEHFQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMSDPAA
PIRRPISAESAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMAEEVTFWKWVSVNTVA
LVTDTAVYHWSMEGDSQPLKVFDRHASLAGCQIINYRTDDHQKWLLLIGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAAFAEFKIEGNSKTSTLFCFAVRSPTGGKLHIIEVGQPAAGN
QPFGKKALDVFFPPEAQTDFPVAMQIGVKHGVIYLITKHGYIHMYDLESGTCIYMNRISA
DTVFVTASHEPTSGIIGVNKKGQVLSVCVEEENIVSYATNVLQNPDLGLRMAIRSNLAGA
EELFARKFNTLFAQGSYAEAAKVAASAPKGVLRTSDTIRKFQSVPAQAGQASPLLQYFGI
LLDQGQLNRSESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKAADPTLALSVYL
RASVPSKVIQCFAETGQFQKIVLYAKKVGYTPDWIFLLRSVMRVSPEQGLQLAQMLVQDE
EPLANINQIVDVFMENSLIQQCTSFLLDALKNNRPAEGHLQTRLLEMNLIHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLNPEWLINFFGSLSV
EDSVECLRAMLSANIRQNLQLGVQVASKYHEQLGTQALVDLFESFKSYEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRIPAVVGGLLDVDCAEDVIKNLIMVVRGQF
STEDLVAEVEKRNRLKLLLPWLESRIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELIQVCNENSLFKSEARYLVRRKDPELWASVL
EENNPFRRQLIDQVVQAALSETQDPEEVSVTVKAFMTADLPSELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELYEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLARAQLQKDLVKEAIDSYIKADDPSSYLEV
VEAANRNGNWEDLVKFLHMARKKARESYVETELVFALAKTNRLSELEEFVNGPNNAHIQQ
VGDRCYEEAMYEAAKLLYNNVSNFARLASTLVHLGEYQAAVDSSRKANSTRTWKEVCFAC
VDGQEFRLAQLCGLHIVIHADELEELISYYQDRGYFEELIALLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIMTMMA
HPTEAWKEGQFKDIITKVANVELYYKALRFYLDYKPLLINDLLLVLSPRLDHTRTVRFFS
KVNQLPLVKPYLRSVQNHNNKGVNEALNNLLTEEEDYQGLRASIDAYDNFDNISLAQRLE
KHQLMEFRRIAAYLYKGNNRWRQSVELCKKDRLYKDAMQYAAESRDAELAESLLHEEAQS
TSSGRTCPGAELTGTLTWEQTGLPGAGFESHLRCSAGRLLDWVPLRDGLVPAWPQGAEGL
GPPSSPRRPHSAQEPSPGAVLGHGGPRARAARLERREMGRGGVGEPPGRGVTLGLLLQVD
KLDASESLRRDEEQGAEPAPIVFGQQLMLTAGPTAAPSQGAFSYGYGAPAFPQAPVYSFN
M
NT seq 5226 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagatactgcccatccgcttccaggagcacttccagcttcagaacctgggcatc
aatcctgccaacattggcttcagcacactgacgatggagtctgacaagttcatctgcatc
cgagagaaggtgggggagcaagcgcaggtggtcatcatcgatatgagcgacccggccgcc
cccatccgccggcccatctctgccgaaagcgccatcatgaacccagcttctaaagtcatc
gccctgaaagcgggaaagaccctccagattttcaatatcgagatgaagagtaaaatgaaa
gcccacacgatggcggaggaggtgactttctggaaatgggtctctgtcaacaccgtcgcc
ttggtgaccgacaccgctgtctaccactggagcatggagggggactctcagcccctgaag
gtgtttgaccgccacgcgagtctggccggctgccagatcatcaactacaggactgacgac
caccagaagtggctgctgcttatcggcatctctgcccagcaaaatcgtgtggttggagca
atgcagctttactcagtggacaggaaggtctctcagccaatagaaggccatgctgcagct
tttgccgagttcaaaatagaagggaactccaagacttccactcttttctgttttgctgta
cggagccctacaggtggcaagctgcacatcattgaggtgggccagcctgcagcagggaac
cagccctttgggaagaaagccctcgatgtgttttttcctccggaggctcagacggatttc
cctgtggctatgcagataggagtcaagcacggggtcatttacttgatcacaaagcacggc
tacattcacatgtacgacttggagtctggcacgtgcatctacatgaaccgcatcagcgcc
gacacggtcttcgtcacggcttcccacgagcccacgtctggcattattggcgtgaacaag
aaaggacaggtcttgtcggtctgcgtggaggaggagaacatcgtcagttacgccaccaac
gtgctccagaacccagacctgggcctgcgcatggccattcgcagcaatctggccggggcc
gaggagctctttgcccggaaatttaacaccctgtttgcgcagggcagctacgccgaagcg
gccaaagtggctgcctctgcgcccaagggggtcctgcgcaccagtgacaccatccgcaag
ttccagagtgtgccggcccaggccggccaggcctcccccctgctccagtactttggcatc
ttgctggaccaagggcagctgaacagatccgagtccttggagctctgccggcccgtgctg
cagcagggccgcaagcagctcctggagaaatggctgaaggaggacaagctggagtgttcc
gaggagctgggagacctggtcaaggccgccgaccccactctggcgctcagcgtctacctc
cgggccagcgtgcccagcaaagtgatccagtgctttgctgagacgggccagttccagaag
atcgtgctctacgccaagaaggttgggtacaccccggactggatcttcttgctgaggagt
gtgatgagggtcagcccagagcagggtctgcagctggcgcaaatgctggtgcaagatgag
gagccgttggccaacattaaccagatcgtggatgtcttcatggagaacagcttgatccag
cagtgcacgtctttcttactggatgccttgaagaacaaccgccccgcagaggggcacctc
cagacccgcctcctggagatgaacctcatccatgccccacaggttgcggatgccatcctt
gggaatcagatgtttacccactatgaccgtgcccacattgcccagctctgtgagaaagca
ggcctgctgcagagggccttggagcactacacggacctgtatgacatcaagcgggccgtg
gtccacactcacctcctgaatcctgagtggctcatcaatttctttggctcactgtcagtg
gaggattctgtggagtgcctgcgagcaatgctgtcggccaacatccgccagaacctccag
ctgggcgtgcaagtggcctccaagtaccatgagcagctgggcacgcaggccctcgtggat
ctctttgagtccttcaagagttatgaaggcctcttttacttcctgggctccattgtcaac
tttagtcaggatcccgacgtgcatttcaaatacatccaggctgcctgcaagactgggcag
atcaaggaggtggagagaatatgccgagaaagcaactgctataacccggagcgggtgaag
aacttccttaaggaggcgaagctcacagaccagcttccgctgattatcgtttgcgacaga
tttgattttgttcatgacctggttctgtatttataccgcaacaacctgcagaagtacatc
gaaatctacgttcagaaggtcaaccccagccgcatcccggccgtggtcggagggctgctc
gatgtggactgtgcagaggacgtcattaaaaacttaatcatggtggtgagggggcagttc
tccaccgaggacctggtggctgaagtggagaaaagaaacaggctaaagctgcttctcccg
tggctggaatcgcgaatccacgaaggctgcgaagagccagccacccacaacgccctcgcc
aagatctatatcgacagtaacaataaccccgagcgcttcctccgcgagaacccctactac
gacagccgcgttgtaggtaaatactgtgaaaagagggacccgcatttggcctgtgttgcc
tatgagagggggcagtgtgacctcgagctcattcaggtttgcaatgagaattctctgttc
aaaagtgaagctcgttacctggttcgcagaaaagacccagaactctgggccagtgtcctg
gaggaaaacaacccgttcaggcgacagctcattgaccaggtggtgcaggccgccctgtct
gagacccaggaccccgaggaggtctccgtgaccgtgaaagccttcatgactgctgacctg
cccagcgagctcatcgagctcctcgagaagatcgtgctggataactctgtgtttagtgag
cacaggaatctccagaatctcctcattctgactgccatcaaggcggaccgcacgcgggtg
atggagtacatcaatcggctggataactatgatgccccggacatcgccaacatcgccatc
agcaacgagctctacgaggaagcctttgccatcttcaggaagtttgatgtgaatacgtcg
gccgttcaggtcctcatagagcacattgggaatctggaccgcgcttatgaatttgcagaa
aggtgcaacgagccggcagtgtggagccagctggccagggcccagctgcagaaagacttg
gtgaaagaggccattgactcttacatcaaagccgatgacccctcctcttacctggaagtg
gtggaggccgccaaccgaaacggtaactgggaagatctggttaaatttctacatatggcc
aggaaaaaggcccgagaatcctacgtcgagactgagctcgtttttgctttggctaaaaca
aaccgcctgtctgagctagaagagtttgtcaatggacccaacaatgcccacatccagcag
gttggtgatcgctgctatgaggaggccatgtacgaagcggccaaattgctctacaataac
gtgtccaattttgcccgcctggcatctaccttggtgcatcttggggaatatcaggctgca
gtggacagcagccgcaaggccaacagcaccaggacctggaaggaggtgtgttttgcctgt
gttgatgggcaggagttccggctggctcagttatgtggcctccatattgtaatccatgct
gacgaacttgaggagctaatcagctactaccaggatcggggctactttgaagaactgatt
gccttgctggaggctgccttgggcctagagcgggctcatatggggatgttcaccgagctt
gccatcctgtattccaaattcaagccccagaagatgcgggagcaccttgagctcttctgg
tccagagtcaatattcccaaggtcctgagagctgccgagcaggctcacctctgggctgag
ctcgtgtttctctacgacaagtacgaggagtacgataatgccatcatgaccatgatggcc
catcccacggaggcctggaaagaagggcagttcaaggacatcatcaccaaggtggccaat
gtggagctgtactacaaagcgctccgcttttacttggattacaaacccctcctgatcaat
gacctcctgctggtgctctcgccccgtctggaccacacccgaactgtccggtttttttca
aaggtgaatcagcttcctctggtgaagccctatctgcgctcagtccaaaatcataataat
aagggggtcaatgaggctcttaacaacctgctgactgaggaagaggattaccagggcttg
agggcctccattgatgcctacgacaacttcgacaacatcagcctggcccagcggctggag
aagcaccaactgatggagttccggcggatcgcggcttatttgtacaaaggaaacaaccgc
tggagacagagcgtggagctctgtaagaaagaccgtctctataaggacgccatgcagtac
gcagccgagtccagggacgccgagctggccgagagccttctgcatgaggaggcccagagc
acgtccagcggccggacctgtcctggggccgagctgaccgggacgcttacgtgggaacag
acagggctgccaggagctgggtttgaatcccaccttcgttgctcagccgggaggctcctg
gactgggttcctctgagggatggtctcgtgcccgcctggccccagggggcagaaggcctt
gggcctccttcctcccccaggaggccccattctgcccaggagccctcaccgggggctgtt
ctcgggcacggaggacccagagctcgggccgcccgccttgagaggcgagagatgggccgg
ggaggggttggggagcccccgggccgcggggtcaccctgggcctgctcctgcaggtggac
aagctggacgcctcggagagcctgcggagggacgaggagcagggggcggagccggcgccc
atcgtgttcggccagcagctgatgctgacggcgggccccactgcggcgccttctcagggc
gccttctcctacggctacggggctccggccttcccccaggcccccgtttacagcttcaac
atgtag

DBGET integrated database retrieval system