KEGG   Monodelphis domestica (opossum): 100029287Help
Entry
100029287         CDS       T01031                                 

Definition
clathrin heavy chain 1-like
Orthology
K04646  
clathrin heavy chain
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100029287
   04142 Lysosome
    100029287
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100029287
  Nervous system
   04721 Synaptic vesicle cycle
    100029287
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100029287
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100029287
Exosome [BR:mdo04147]
 Exosomal proteins
  Proteins found in most exosomes
   100029287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 1741 aa AA seqDB search
MAQILPIRFQEHFQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMSDPAA
PIRRPISAESAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMAEEVTFWKWVSVNTVA
LVTDTAVYHWSMEGDSQPLKVFDRHASLAGCQIINYRTDDHQKWLLLIGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAAFAEFKIEGNSKTSTLFCFAVRSPTGGKLHIIEVGQPAAGN
QPFGKKALDVFFPPEAQTDFPVAMQIGVKHGVIYLITKHGYIHMYDLESGTCIYMNRISA
DTVFVTASHEPTSGIIGVNKKGQVLSVCVEEENIVSYATNVLQNPDLGLRMAIRSNLAGA
EELFARKFNTLFAQGSYAEAAKVAASAPKGVLRTSDTIRKFQSVPAQAGQASPLLQYFGI
LLDQGQLNRSESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKAADPTLALSVYL
RASVPSKVIQCFAETGQFQKIVLYAKKVGYTPDWIFLLRSVMRVSPEQGLQLAQMLVQDE
EPLANINQIVDVFMENSLIQQCTSFLLDALKNNRPAEGHLQTRLLEMNLIHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLNPEWLINFFGSLSV
EDSVECLRAMLSANIRQNLQLGVQVASKYHEQLGTQALVDLFESFKSYEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRIPAVVGGLLDVDCAEDVIKNLIMVVRGQF
STEDLVAEVEKRNRLKLLLPWLESRIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELIQVCNENSLFKSEARYLVRRKDPELWASVL
EENNPFRRQLIDQVVQAALSETQDPEEVSVTVKAFMTADLPSELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELYEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLARAQLQKDLVKEAIDSYIKADDPSSYLEV
VEAANRNGNWEDLVKFLHMARKKARESYVETELVFALAKTNRLSELEEFVNGPNNAHIQQ
VGDRCYEEAMYEAAKLLYNNVSNFARLASTLVHLGEYQAAVDSSRKANSTRTWKEVCFAC
VDGQEFRLAQLCGLHIVIHADELEELISYYQDRGYFEELIALLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIMTMMA
HPTEAWKEGQFKDIITKVANVELYYKALRFYLDYKPLLINDLLLVLSPRLDHTRTVRFFS
KVNQLPLVKPYLRSVQNHNNKGVNEALNNLLTEEEDYQGLRASIDAYDNFDNISLAQRLE
KHQLMEFRRIAAYLYKGNNRWRQSVELCKKDRLYKDAMQYAAESRDAELAESLLHEEAQS
TSSGRTCPGAELTGTLTWEQTGLPGAGFESHLRCSAGRLLDWVPLRDGLVPAWPQGAEGL
GPPSSPRRPHSAQEPSPGAVLGHGGPRARAARLERREMGRGGVGEPPGRGVTLGLLLQVD
KLDASESLRRDEEQGAEPAPIVFGQQLMLTAGPTAAPSQGAFSYGYGAPAFPQAPVYSFN
M
NT seq 5226 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagatactgcccatccgcttccaggagcacttccagcttcagaacctgggcatc
aatcctgccaacattggcttcagcacactgacgatggagtctgacaagttcatctgcatc
cgagagaaggtgggggagcaagcgcaggtggtcatcatcgatatgagcgacccggccgcc
cccatccgccggcccatctctgccgaaagcgccatcatgaacccagcttctaaagtcatc
gccctgaaagcgggaaagaccctccagattttcaatatcgagatgaagagtaaaatgaaa
gcccacacgatggcggaggaggtgactttctggaaatgggtctctgtcaacaccgtcgcc
ttggtgaccgacaccgctgtctaccactggagcatggagggggactctcagcccctgaag
gtgtttgaccgccacgcgagtctggccggctgccagatcatcaactacaggactgacgac
caccagaagtggctgctgcttatcggcatctctgcccagcaaaatcgtgtggttggagca
atgcagctttactcagtggacaggaaggtctctcagccaatagaaggccatgctgcagct
tttgccgagttcaaaatagaagggaactccaagacttccactcttttctgttttgctgta
cggagccctacaggtggcaagctgcacatcattgaggtgggccagcctgcagcagggaac
cagccctttgggaagaaagccctcgatgtgttttttcctccggaggctcagacggatttc
cctgtggctatgcagataggagtcaagcacggggtcatttacttgatcacaaagcacggc
tacattcacatgtacgacttggagtctggcacgtgcatctacatgaaccgcatcagcgcc
gacacggtcttcgtcacggcttcccacgagcccacgtctggcattattggcgtgaacaag
aaaggacaggtcttgtcggtctgcgtggaggaggagaacatcgtcagttacgccaccaac
gtgctccagaacccagacctgggcctgcgcatggccattcgcagcaatctggccggggcc
gaggagctctttgcccggaaatttaacaccctgtttgcgcagggcagctacgccgaagcg
gccaaagtggctgcctctgcgcccaagggggtcctgcgcaccagtgacaccatccgcaag
ttccagagtgtgccggcccaggccggccaggcctcccccctgctccagtactttggcatc
ttgctggaccaagggcagctgaacagatccgagtccttggagctctgccggcccgtgctg
cagcagggccgcaagcagctcctggagaaatggctgaaggaggacaagctggagtgttcc
gaggagctgggagacctggtcaaggccgccgaccccactctggcgctcagcgtctacctc
cgggccagcgtgcccagcaaagtgatccagtgctttgctgagacgggccagttccagaag
atcgtgctctacgccaagaaggttgggtacaccccggactggatcttcttgctgaggagt
gtgatgagggtcagcccagagcagggtctgcagctggcgcaaatgctggtgcaagatgag
gagccgttggccaacattaaccagatcgtggatgtcttcatggagaacagcttgatccag
cagtgcacgtctttcttactggatgccttgaagaacaaccgccccgcagaggggcacctc
cagacccgcctcctggagatgaacctcatccatgccccacaggttgcggatgccatcctt
gggaatcagatgtttacccactatgaccgtgcccacattgcccagctctgtgagaaagca
ggcctgctgcagagggccttggagcactacacggacctgtatgacatcaagcgggccgtg
gtccacactcacctcctgaatcctgagtggctcatcaatttctttggctcactgtcagtg
gaggattctgtggagtgcctgcgagcaatgctgtcggccaacatccgccagaacctccag
ctgggcgtgcaagtggcctccaagtaccatgagcagctgggcacgcaggccctcgtggat
ctctttgagtccttcaagagttatgaaggcctcttttacttcctgggctccattgtcaac
tttagtcaggatcccgacgtgcatttcaaatacatccaggctgcctgcaagactgggcag
atcaaggaggtggagagaatatgccgagaaagcaactgctataacccggagcgggtgaag
aacttccttaaggaggcgaagctcacagaccagcttccgctgattatcgtttgcgacaga
tttgattttgttcatgacctggttctgtatttataccgcaacaacctgcagaagtacatc
gaaatctacgttcagaaggtcaaccccagccgcatcccggccgtggtcggagggctgctc
gatgtggactgtgcagaggacgtcattaaaaacttaatcatggtggtgagggggcagttc
tccaccgaggacctggtggctgaagtggagaaaagaaacaggctaaagctgcttctcccg
tggctggaatcgcgaatccacgaaggctgcgaagagccagccacccacaacgccctcgcc
aagatctatatcgacagtaacaataaccccgagcgcttcctccgcgagaacccctactac
gacagccgcgttgtaggtaaatactgtgaaaagagggacccgcatttggcctgtgttgcc
tatgagagggggcagtgtgacctcgagctcattcaggtttgcaatgagaattctctgttc
aaaagtgaagctcgttacctggttcgcagaaaagacccagaactctgggccagtgtcctg
gaggaaaacaacccgttcaggcgacagctcattgaccaggtggtgcaggccgccctgtct
gagacccaggaccccgaggaggtctccgtgaccgtgaaagccttcatgactgctgacctg
cccagcgagctcatcgagctcctcgagaagatcgtgctggataactctgtgtttagtgag
cacaggaatctccagaatctcctcattctgactgccatcaaggcggaccgcacgcgggtg
atggagtacatcaatcggctggataactatgatgccccggacatcgccaacatcgccatc
agcaacgagctctacgaggaagcctttgccatcttcaggaagtttgatgtgaatacgtcg
gccgttcaggtcctcatagagcacattgggaatctggaccgcgcttatgaatttgcagaa
aggtgcaacgagccggcagtgtggagccagctggccagggcccagctgcagaaagacttg
gtgaaagaggccattgactcttacatcaaagccgatgacccctcctcttacctggaagtg
gtggaggccgccaaccgaaacggtaactgggaagatctggttaaatttctacatatggcc
aggaaaaaggcccgagaatcctacgtcgagactgagctcgtttttgctttggctaaaaca
aaccgcctgtctgagctagaagagtttgtcaatggacccaacaatgcccacatccagcag
gttggtgatcgctgctatgaggaggccatgtacgaagcggccaaattgctctacaataac
gtgtccaattttgcccgcctggcatctaccttggtgcatcttggggaatatcaggctgca
gtggacagcagccgcaaggccaacagcaccaggacctggaaggaggtgtgttttgcctgt
gttgatgggcaggagttccggctggctcagttatgtggcctccatattgtaatccatgct
gacgaacttgaggagctaatcagctactaccaggatcggggctactttgaagaactgatt
gccttgctggaggctgccttgggcctagagcgggctcatatggggatgttcaccgagctt
gccatcctgtattccaaattcaagccccagaagatgcgggagcaccttgagctcttctgg
tccagagtcaatattcccaaggtcctgagagctgccgagcaggctcacctctgggctgag
ctcgtgtttctctacgacaagtacgaggagtacgataatgccatcatgaccatgatggcc
catcccacggaggcctggaaagaagggcagttcaaggacatcatcaccaaggtggccaat
gtggagctgtactacaaagcgctccgcttttacttggattacaaacccctcctgatcaat
gacctcctgctggtgctctcgccccgtctggaccacacccgaactgtccggtttttttca
aaggtgaatcagcttcctctggtgaagccctatctgcgctcagtccaaaatcataataat
aagggggtcaatgaggctcttaacaacctgctgactgaggaagaggattaccagggcttg
agggcctccattgatgcctacgacaacttcgacaacatcagcctggcccagcggctggag
aagcaccaactgatggagttccggcggatcgcggcttatttgtacaaaggaaacaaccgc
tggagacagagcgtggagctctgtaagaaagaccgtctctataaggacgccatgcagtac
gcagccgagtccagggacgccgagctggccgagagccttctgcatgaggaggcccagagc
acgtccagcggccggacctgtcctggggccgagctgaccgggacgcttacgtgggaacag
acagggctgccaggagctgggtttgaatcccaccttcgttgctcagccgggaggctcctg
gactgggttcctctgagggatggtctcgtgcccgcctggccccagggggcagaaggcctt
gggcctccttcctcccccaggaggccccattctgcccaggagccctcaccgggggctgtt
ctcgggcacggaggacccagagctcgggccgcccgccttgagaggcgagagatgggccgg
ggaggggttggggagcccccgggccgcggggtcaccctgggcctgctcctgcaggtggac
aagctggacgcctcggagagcctgcggagggacgaggagcagggggcggagccggcgccc
atcgtgttcggccagcagctgatgctgacggcgggccccactgcggcgccttctcagggc
gccttctcctacggctacggggctccggccttcccccaggcccccgtttacagcttcaac
atgtag

DBGET integrated database retrieval system