KEGG   Monodelphis domestica (opossum): 100029336Help
Entry
100029336         CDS       T01031                                 

Gene name
EIF3B
Definition
eukaryotic translation initiation factor 3, subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
mdo  Monodelphis domestica (opossum)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100029336 (EIF3B)
Translation factors [BR:mdo03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100029336 (EIF3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 836 aa AA seqDB search
MQDAENVAVPEAAEQRAEPEQQAAEEEPERPAGPGAQEAAAAAAAVLVPEVKGEKGDTTV
SVVKPGSEPEAIVKLLAEEKAVVEPASAEPPPLVSPPPGESQPPPTDKVPEPKAEPPAAK
EEKREEKEKAEEGVGKEEEEKEEEEKGGEKEDENKEAEAEQRRLENSNEEDEISFSDPEG
FVDDISEDELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKIT
NDYYPEEDGKTKGYIFLEYVSPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDE
WDIPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTET
YVRWSPKGTYLATFHQRGIALWGGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQ
DDPQAIIIWDILTGQKKRGFHCESSAHWPIFKWSHDGKFFARMTMDTLSIYETPSMGLLD
KKSLKIPGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPSRQEIRVRNLFNVVDCKLH
WQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMKESIIAFAWEPNGSKFA
VLHGEAPRISVSFYHVKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFV
DTSDCTMMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDR
FCQLLWRPRPPTLLSQDQIKQIKKDLKRYSKIFEQKDRLSQSKASKELVERRRTMMEDFR
KYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIPLGNQE
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgcagagaacgtggcggtgcccgaagcggccgagcagcgggctgagccggag
cagcaggccgccgaggaggaaccggagcggcctgctgggcccggggcccaggaagcggcg
gcggccgccgctgctgtgcttgtgccggaggtgaagggagaaaagggagacaccacagtg
tctgtagtcaagccggggtctgagcccgaggcaatcgttaagcttctcgccgaagagaag
gccgtggttgaaccggcttcggccgaaccgccgccactggtatcaccgcctccgggcgag
tctcagccgccaccgaccgataaggttccggagcccaaggctgaacccccggcagctaag
gaggagaaacgggaggagaaggaaaaggcagaggaaggagtagggaaggaggaagaggaa
aaagaggaggaggagaaagggggcgagaaggaagacgaaaataaggaggctgaggccgag
cagaggcgcctggagaatagcaacgaagaggacgagatctccttcagtgatcccgagggc
ttcgtggacgacattagtgaggacgaattgctgggagatgtactcaaagatagaccacag
gaagctgatggaattgattctgtgatagtggtggacaatgttcctcaggtaggacctgac
cgtcttgagaaactaaagaatgtcatccacaagatcttctccaaatttgggaaaataacc
aatgattattacccagaagaagatggaaagactaaaggttacattttcctagagtatgtc
tcccccgctcatgccctggatgctgttaaaaatgctgatggctacaagcttgacaaacag
cacacattcagagtaaaccttttcactgactttgacaagtatatgacaatcagtgatgag
tgggacattccagagaagcagcctttcaaagatttgggaaatctacgctattggctggag
gaggctgaatgcagagatcagtatagtgtcatctttgaatccggggaccgtacatccata
ttctggaatgatgtgaaggatccagtctccattgaagaaagagcgagatggacagaaacc
tatgtgcgctggtccccaaagggcacttacttggctaccttccatcaaagaggaattgct
ttatgggggggagaaaaattcaaacaaattcagcgattcagccaccagggggtgcaactt
attgacttctcaccttgtgaaaggtatcttgtgactttcagtcctctaatggacacacag
gatgaccctcaggccataattatatgggacatcctcactggacagaagaaacgaggattt
cattgtgaaagctctgcccattggcccatttttaagtggagtcatgatggcaaatttttt
gcccgaatgacgatggatactctcagcatctatgagactccatctatgggccttttggat
aagaagagtttgaaaatccctggaataaaagacttttcttggtcacctggtggtaacata
atcgctttttgggtgccagaagataaggacattcctgccagagtgaccttgatgcaactc
cccagcagacaagaaatcagagttagaaatctgtttaatgttgttgactgtaaactacat
tggcaaaagaatggagattacttgtgtgtcaaagtagatagaactccaaaaggtacccag
ggtgtggtcaccaactttgaaatcttccgaatgagagaaaagcaggtgcctgttgatgta
gtagaaatgaaagaaagcataattgcctttgcttgggaaccaaatggaagtaagtttgct
gtcctacatggtgaggctcctcgaatatcagtttccttctatcatgtgaaaaacaatgga
aagattgaacttatcaaaatgtttgataaacagcaggcaaacacaatcttttggagtccc
caaggacaatttgttgttctagctggtctaaggagcatgaatggtgccctggcatttgtt
gatacatcagattgtaccatgatgaatattgcagaacactatatggcttctgatgttgag
tgggaccctacaggccgttatgttgtaacttctgtgtcctggtggagccacaaggtagat
aatgcctactggctatggactttccaaggacgtctccttcaaaagaataacaaggatcgt
ttctgccagttattgtggaggcctcggcccccaactctgctcagccaggatcagataaag
caaattaaaaaggatctgaagagatactccaagatttttgaacaaaaggatcgtttgagc
caatccaaagcctcaaaggaattggtagagaggagacgtacaatgatggaagattttaga
aaataccggaaaatggctcaagagctttatatggagcagaaaaatgagcgtctggaatta
cgaggaggggtagacactgatgaactagatagcaatgtagatgattgggaagaagagaca
attgaattttttgtcactgaagaaatcattccccttggaaatcaggagtag

DBGET integrated database retrieval system