KEGG   Monodelphis domestica (opossum): 100029336Help
Entry
100029336         CDS       T01031                                 

Gene name
EIF3B
Definition
eukaryotic translation initiation factor 3, subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
mdo  Monodelphis domestica (opossum)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:mdo03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 815 aa AA seqDB search
MQDAENVAVPEAAEQRAEPEQQAAEEEPERPAGPGAQEAAAAAAAVLVPEVKGEKGDTTV
SVVKPGSEPEAIVKLLAEEKAVVEPASAEPPPLVSPPPGESQPPPTDKVPEPKAEPPAAK
EEKREEKEKEDENKEAEAEQRRLENSNEEDEISFSDPEGFVDDISEDELLGDVLKDRPQE
ADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDYYPEEDGKTKGYIFLEYVS
PAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEE
AECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLATFHQRGIAL
WGGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGQKKRGFH
CESSAHWPIFKWSHDGKFFARMTMDTLSIYETPSMGLLDKKSLKIPGIKDFSWSPGGNII
AFWVPEDKDIPARVTLMQLPSRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQG
VVTNFEIFRMREKQVPVDVVEMKESIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKNNGK
IELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTMMNIAEHYMASDVEW
DPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQDQIKQ
IKKDLKRYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELR
GGVDTDELDSNVDDWEEETIEFFVTEEIIPLGNQE
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgcagagaacgtggcggtgcccgaagcggccgagcagcgggctgagccggag
cagcaggccgccgaggaggaaccggagcggcctgctgggcccggggcccaggaagcggcg
gcggccgccgctgctgtgcttgtgccggaggtgaagggagaaaagggagacaccacagtg
tctgtagtcaagccggggtctgagcccgaggcaatcgttaagcttctcgccgaagagaag
gccgtggttgaaccggcttcggccgaaccgccgccactggtatcaccgcctccgggcgag
tctcagccgccaccgaccgataaggttccggagcccaaggctgaacccccggcagctaag
gaggagaaacgggaggagaaggaaaaggaagacgaaaataaggaggctgaggccgagcag
aggcgcctggagaatagcaacgaagaggacgagatctccttcagtgatcccgagggcttc
gtggacgacattagtgaggacgaattgctgggagatgtactcaaagatagaccacaggaa
gctgatggaattgattctgtgatagtggtggacaatgttcctcaggtaggacctgaccgt
cttgagaaactaaagaatgtcatccacaagatcttctccaaatttgggaaaataaccaat
gattattacccagaagaagatggaaagactaaaggttacattttcctagagtatgtctcc
cccgctcatgccctggatgctgttaaaaatgctgatggctacaagcttgacaaacagcac
acattcagagtaaaccttttcactgactttgacaagtatatgacaatcagtgatgagtgg
gacattccagagaagcagcctttcaaagatttgggaaatctacgctattggctggaggag
gctgaatgcagagatcagtatagtgtcatctttgaatccggggaccgtacatccatattc
tggaatgatgtgaaggatccagtctccattgaagaaagagcgagatggacagaaacctat
gtgcgctggtccccaaagggcacttacttggctaccttccatcaaagaggaattgcttta
tgggggggagaaaaattcaaacaaattcagcgattcagccaccagggggtgcaacttatt
gacttctcaccttgtgaaaggtatcttgtgactttcagtcctctaatggacacacaggat
gaccctcaggccataattatatgggacatcctcactggacagaagaaacgaggatttcat
tgtgaaagctctgcccattggcccatttttaagtggagtcatgatggcaaattttttgcc
cgaatgacgatggatactctcagcatctatgagactccatctatgggccttttggataag
aagagtttgaaaatccctggaataaaagacttttcttggtcacctggtggtaacataatc
gctttttgggtgccagaagataaggacattcctgccagagtgaccttgatgcaactcccc
agcagacaagaaatcagagttagaaatctgtttaatgttgttgactgtaaactacattgg
caaaagaatggagattacttgtgtgtcaaagtagatagaactccaaaaggtacccagggt
gtggtcaccaactttgaaatcttccgaatgagagaaaagcaggtgcctgttgatgtagta
gaaatgaaagaaagcataattgcctttgcttgggaaccaaatggaagtaagtttgctgtc
ctacatggtgaggctcctcgaatatcagtttccttctatcatgtgaaaaacaatggaaag
attgaacttatcaaaatgtttgataaacagcaggcaaacacaatcttttggagtccccaa
ggacaatttgttgttctagctggtctaaggagcatgaatggtgccctggcatttgttgat
acatcagattgtaccatgatgaatattgcagaacactatatggcttctgatgttgagtgg
gaccctacaggccgttatgttgtaacttctgtgtcctggtggagccacaaggtagataat
gcctactggctatggactttccaaggacgtctccttcaaaagaataacaaggatcgtttc
tgccagttattgtggaggcctcggcccccaactctgctcagccaggatcagataaagcaa
attaaaaaggatctgaagagatactccaagatttttgaacaaaaggatcgtttgagccaa
tccaaagcctcaaaggaattggtagagaggagacgtacaatgatggaagattttagaaaa
taccggaaaatggctcaagagctttatatggagcagaaaaatgagcgtctggaattacga
ggaggggtagacactgatgaactagatagcaatgtagatgattgggaagaagagacaatt
gaattttttgtcactgaagaaatcattccccttggaaatcaggagtag

DBGET integrated database retrieval system