KEGG   Monodelphis domestica (opossum): 100029343Help
Entry
100029343         CDS       T01031                                 

Gene name
POM121C
Definition
(RefSeq) nuclear envelope pore membrane protein POM 121
  KO
K14316  
nuclear pore complex protein Nup121
Organism
mdo  Monodelphis domestica (opossum)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100029343 (POM121C)
Messenger RNA biogenesis [BR:mdo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100029343 (POM121C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 1241 aa AA seqDB search
MSPAAAAAAAGAVAGTGSGTGGGSGAERRERRRRAAAGGGGGGRGAWARGRPGGAAALLG
LVLLGLVLYLVPAAAALAWLGVGAAAAWWGLSAREPAPRGLRCCPPPPAASKPRARRPPP
LLPAKAAVNGAPLPLPPLGPEPSAQPPLMGGYLGKPGPPEPPRPAPTGLHRPPSASSPQL
LSPARRLQLRDHLTPPSRFSLVPRRRYPIQQTQYSALGTFPTVSWEGLQRKNVLSARNSY
MVSSPVTVRIARPDSSLPHPPLEQVVNSAMPSPSSDTPDPCSKETVMNALKESRKRAVEE
DDQIFSDAQENKRRRHDSSGSGQSAFEPLVANGAPASLVPKPGSLKRSLTSQGTEDNLNK
RSRTSSTSSLTSTYPGGIPSSMRNAITSSYSSSRGFSQLWKRSGPSTSPLSSPASSRSQT
PERPMKKAREEEFHQSSCLTPVTSDKESQADKVIDTPTRKKQSSWQSPPTSGSGGKRRRK
VQLLASRRGDQLTLPPPPQLGYSVTAEDLDLEKKAALKWFNKVLEEKPDPTPPPSVAEAS
PAPKPASFTLPSPKTTSSPATAAPPTSSTNPLLDSLKKMQNSPSPAAPTDLAGAAATGAP
SPLKTASPPAAPGPSEPGPPATTTTTTTTTNTTSSSSKAIPTFSLTSSASQASSVPVSDS
SSKPPATASPKPSILFGMLSSPSPAPTPPAPAATPAPAATPAAPPATPSPMFKPIFGAPP
KMESGASLPAAPSTTTSVSCSSVLSTAPSTSTTTFKPIFGNMGPPTSVSLASTSPFLKQP
SSVAPTTTVTTAVQGPLFSGLPTIQPTAAPATTASASASATTSASSSGTTDSGSKPTFSF
GLSSLASATTSAPATTPSTSSTSTAAPSGSQPFLFGAAPAPSASFTPSTGSVFQFSKPSA
AVTTAVAVTTFGATQTAPSSTAGFGFGGTVSTAALPTTSQVTLTFGPSTTTTAFSTPFSS
SVKTLPPPPYPGATSQPAFGTADGQQQQQQQQQQQQAANKVGPATSFSSTFNFGGSTAPS
PALAQPAFGGTKPLTSFGAPASTQPAFGGTNTVFSFGTTTTSNFGATTQTTSSGTGSSMF
GGMNLAPFTFGSSTAATSSGGFGVSAAVPGTSSSSAAFSFGAGQSGTASATAPFGGSLNQ
NPLGAPSQSAPFAFSVANTPENKPVFGGTSTPTFGQNAPTPGAGTVGSSLSFGAPSTPAQ
GFVGAGPSFGPSTPSFSIGAGSKTPGARQRLQARRQHTRKK
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atgtctccggctgcggctgcggcggcggccggggctgtggccggcaccgggagtgggacc
ggaggcggctccggggccgaacggagagagcggaggcggcgggctgcggcgggcggcggc
ggaggagggcggggtgcctgggcgcggggccggccgggaggcgcggcggcgctgctgggc
ctggtgctgctgggcctcgtgctgtacttggtgccggcggcggcggcgctggcctggctg
ggcgtgggggccgccgcagcctggtggggcctgagcgcccgcgagccggccccccggggc
ctgcgctgctgcccgccgccccctgccgcctccaagccgcgagcccgccgtcccccgccg
ctgctgcccgccaaggccgcggtaaacggggccccgctgccgctgccgcctctgggtccc
gagccctccgcacagccgccgctcatgggcggttacctgggcaagcccggcccgcccgag
cccccgcggcccgcgcccactggcctccaccgcccgccctccgcctcctcgccgcagctg
ctgagcccagcccgcaggctccagctcagggaccacctcactcctccaagtcggttctca
ttagttccacggaggagatatccaattcagcagacacagtattctgcattggggaccttt
cccacagtgtcttgggaaggccttcagagaaaaaatgtgctctctgctcgaaactcctac
atggtatcaagccctgtgaccgtgaggattgctcgtccagatagcagtctgccccatccc
cccctggagcaggtcgtgaattcagctatgccttcaccatccagtgataccccagaccca
tgttcaaaggagactgtgatgaatgcacttaaagagagtcggaaaagggcagtggaggaa
gatgatcagatcttctctgatgcccaggaaaataaacgaaggcgccacgacagcagtggg
agtggacagtcagcatttgaacccctcgtggcaaatggagccccagcatctcttgttccc
aagcctggatctctgaagagaagcctcacttcccagggtacagaggataacttgaataag
agatcccgtacctcgtccactagctctttgactagcacctacccagggggcatcccaagc
tccatgcgtaatgccatcaccagctcctacagttccagcaggggtttctcccagctctgg
aagaggagtggccccagtacctcacctctctctagccccgcctcatctcgatcccagacc
ccagagaggcctatgaagaaagcacgagaagaagagtttcatcagtctagctgtttgact
cccgtgacttcagacaaggaatcccaggcagacaaggtgatagatacccccaccagaaag
aagcagagctcctggcagtcccctcctacctctggcagtggtggaaagcgcaggcgaaag
gttcagttattggcttctcggcgaggagaccagctcaccctgcccccacctccccagctt
ggttattcagtcactgctgaagacctagacttagaaaagaaggctgcattgaagtggttt
aacaaagtcttggaggagaagccagatcccacgccaccaccctctgtcgccgaggcctcc
cctgcccccaagccagcctccttcaccctaccgtccccaaagaccacttcctcacctgct
acagctgctcctccaacttccagtaccaaccccctgctggatagtctgaagaagatgcag
aactccccaagccctgcagcccccacagacctggctggagcagcagctactggggcccct
tcccctctgaagacagccagcccaccagctgccccggggccctcagagccagggccccct
gccaccaccaccaccactaccaccaccaccaacaccacctcttcttcctccaaagccatc
ccaaccttctccttgacctcttcagccagccaggcctcctcagtgccagtgtcggacagc
tctagcaagccccccgccacagcttcccccaagcctagcattctctttggaatgctgagt
agcccttccccggcccccacccctcctgccccagcagcgactcctgccccagcagcaact
cctgctgcccctcctgccactcccagccccatgttcaaacccatttttggggccccccct
aaaatggaaagtggggcttccttgccggctgccccttccaccaccacttctgtgtcttgt
agttctgtcctctccactgctcccagcacctccacaacaacctttaagcccatctttggt
aacatgggcccacctacatctgtgtccttggcctccacttcccccttcttgaaacaaccc
tcttctgtagcccccaccacaactgtcaccacagctgtccaggggcccctctttagtggc
ctccccaccatccagcccactgctgcacctgccaccaccgcctctgcctccgcctctgcc
accacctctgcctcatccagtgggaccactgactcaggctccaaacctaccttcagcttt
gggctgagcagcttggccagtgccacaaccagtgcccccgccaccacccccagcaccagc
agcacatcaactgctgccccctcgggatcccagcctttcctctttggagctgctcctgcc
cccagcgccagcttcaccccgtctactggctctgtattccagtttagtaagccctcggct
gctgttaccactgcagtagcagtcacaacctttggtgccacacagacggcccccagcagc
actgctggctttgggtttgggggcaccgtcagcacagcagccctgccgaccaccagccaa
gtgaccttgacatttggcccctccactaccaccacagcattcagcacccctttcagctcc
agcgtcaagacgctgccacccccaccctaccccggagccacatctcagcctgcttttggg
actgcagacgggcagcagcagcagcagcagcagcagcagcagcagcaggcagccaacaaa
gtgggccctgccacgagcttcagtagcacgttcaactttggaggttctacagccccaagc
ccggcccttgcccagccagcctttggtgggacaaagccactcacctcctttggggcccct
gccagcacgcagccagcctttggtggcaccaacacggtcttctcttttggcacaaccacc
acctccaacttcggggccaccacgcagaccaccagcagtggtactggcagttccatgttt
ggtggcatgaacctggcccctttcacatttgggagctccacagctgcaaccagcagtgga
ggctttggggtcagtgcagctgtccctggaaccagttcatccagtgcagccttcagcttt
ggagcaggccagagcggaacagccagtgccactgccccctttgggggttccttgaaccag
aaccccctaggtgccccaagtcaaagtgcaccctttgccttcagcgtggccaacaccccg
gagaacaagcctgtttttggaggcacttccacacctacctttggccagaatgctccaacc
cccggagcaggcacagtgggcagtagcctttcctttggggccccaagcaccccagcccag
ggctttgtgggagcagggccatcttttggaccatcgaccccttcgttttccattggtgca
ggatccaagacccctggggccaggcagcgactacaggcccggagacagcatactcgaaag
aaatag

DBGET integrated database retrieval system