KEGG   Monodelphis domestica (opossum): 100029343Help
Entry
100029343         CDS       T01031                                 

Gene name
POM121C
Definition
POM121 transmembrane nucleoporin C
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
mdo  Monodelphis domestica (opossum)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100029343 (POM121C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 1241 aa AA seqDB search
MSPAAAAAAAGAVAGTGSGTGGGSGAERRERRRRAAAGGGGGGRGAWARGRPGGAAALLG
LVLLGLVLYLVPAAAALAWLGVGAAAAWWGLSAREPAPRGLRCCPPPPAASKPRARRPPP
LLPAKAAVNGAPLPLPPLGPEPSAQPPLMGGYLGKPGPPEPPRPAPTGLHRPPSASSPQL
LSPARRLQLRDHLTPPSRFSLVPRRRYPIQQTQYSALGTFPTVSWEGLQRKNVLSARNSY
MVSSPVTVRIARPDSSLPHPPLEQVVNSAMPSPSSDTPDPCSKETVMNALKESRKRAVEE
DDQIFSDAQENKRRRHDSSGSGQSAFEPLVANGAPASLVPKPGSLKRSLTSQGTEDNLNK
RSRTSSTSSLTSTYPGGIPSSMRNAITSSYSSSRGFSQLWKRSGPSTSPLSSPASSRSQT
PERPMKKAREEEFHQSSCLTPVTSDKESQADKVIDTPTRKKQSSWQSPPTSGSGGKRRRK
VQLLASRRGDQLTLPPPPQLGYSVTAEDLDLEKKAALKWFNKVLEEKPDPTPPPSVAEAS
PAPKPASFTLPSPKTTSSPATAAPPTSSTNPLLDSLKKMQNSPSPAAPTDLAGAAATGAP
SPLKTASPPAAPGPSEPGPPATTTTTTTTTNTTSSSSKAIPTFSLTSSASQASSVPVSDS
SSKPPATASPKPSILFGMLSSPSPAPTPPAPAATPAPAATPAAPPATPSPMFKPIFGAPP
KMESGASLPAAPSTTTSVSCSSVLSTAPSTSTTTFKPIFGNMGPPTSVSLASTSPFLKQP
SSVAPTTTVTTAVQGPLFSGLPTIQPTAAPATTASASASATTSASSSGTTDSGSKPTFSF
GLSSLASATTSAPATTPSTSSTSTAAPSGSQPFLFGAAPAPSASFTPSTGSVFQFSKPSA
AVTTAVAVTTFGATQTAPSSTAGFGFGGTVSTAALPTTSQVTLTFGPSTTTTAFSTPFSS
SVKTLPPPPYPGATSQPAFGTADGQQQQQQQQQQQQAANKVGPATSFSSTFNFGGSTAPS
PALAQPAFGGTKPLTSFGAPASTQPAFGGTNTVFSFGTTTTSNFGATTQTTSSGTGSSMF
GGMNLAPFTFGSSTAATSSGGFGVSAAVPGTSSSSAAFSFGAGQSGTASATAPFGGSLNQ
NPLGAPSQSAPFAFSVANTPENKPVFGGTSTPTFGQNAPTPGAGTVGSSLSFGAPSTPAQ
GFVGAGPSFGPSTPSFSIGAGSKTPGARQRLQARRQHTRKK
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atgtctccggctgcggctgcggcggcggccggggctgtggccggcaccgggagtgggacc
ggaggcggctccggggccgaacggagagagcggaggcggcgggctgcggcgggcggcggc
ggaggagggcggggtgcctgggcgcggggccggccgggaggcgcggcggcgctgctgggc
ctggtgctgctgggcctcgtgctgtacttggtgccggcggcggcggcgctggcctggctg
ggcgtgggggccgccgcagcctggtggggcctgagcgcccgcgagccggccccccggggc
ctgcgctgctgcccgccgccccctgccgcctccaagccgcgagcccgccgtcccccgccg
ctgctgcccgccaaggccgcggtaaacggggccccgctgccgctgccgcctctgggtccc
gagccctccgcacagccgccgctcatgggcggttacctgggcaagcccggcccgcccgag
cccccgcggcccgcgcccactggcctccaccgcccgccctccgcctcctcgccgcagctg
ctgagcccagcccgcaggctccagctcagggaccacctcactcctccaagtcggttctca
ttagttccacggaggagatatccaattcagcagacacagtattctgcattggggaccttt
cccacagtgtcttgggaaggccttcagagaaaaaatgtgctctctgctcgaaactcctac
atggtatcaagccctgtgaccgtgaggattgctcgtccagatagcagtctgccccatccc
cccctggagcaggtcgtgaattcagctatgccttcaccatccagtgataccccagaccca
tgttcaaaggagactgtgatgaatgcacttaaagagagtcggaaaagggcagtggaggaa
gatgatcagatcttctctgatgcccaggaaaataaacgaaggcgccacgacagcagtggg
agtggacagtcagcatttgaacccctcgtggcaaatggagccccagcatctcttgttccc
aagcctggatctctgaagagaagcctcacttcccagggtacagaggataacttgaataag
agatcccgtacctcgtccactagctctttgactagcacctacccagggggcatcccaagc
tccatgcgtaatgccatcaccagctcctacagttccagcaggggtttctcccagctctgg
aagaggagtggccccagtacctcacctctctctagccccgcctcatctcgatcccagacc
ccagagaggcctatgaagaaagcacgagaagaagagtttcatcagtctagctgtttgact
cccgtgacttcagacaaggaatcccaggcagacaaggtgatagatacccccaccagaaag
aagcagagctcctggcagtcccctcctacctctggcagtggtggaaagcgcaggcgaaag
gttcagttattggcttctcggcgaggagaccagctcaccctgcccccacctccccagctt
ggttattcagtcactgctgaagacctagacttagaaaagaaggctgcattgaagtggttt
aacaaagtcttggaggagaagccagatcccacgccaccaccctctgtcgccgaggcctcc
cctgcccccaagccagcctccttcaccctaccgtccccaaagaccacttcctcacctgct
acagctgctcctccaacttccagtaccaaccccctgctggatagtctgaagaagatgcag
aactccccaagccctgcagcccccacagacctggctggagcagcagctactggggcccct
tcccctctgaagacagccagcccaccagctgccccggggccctcagagccagggccccct
gccaccaccaccaccactaccaccaccaccaacaccacctcttcttcctccaaagccatc
ccaaccttctccttgacctcttcagccagccaggcctcctcagtgccagtgtcggacagc
tctagcaagccccccgccacagcttcccccaagcctagcattctctttggaatgctgagt
agcccttccccggcccccacccctcctgccccagcagcgactcctgccccagcagcaact
cctgctgcccctcctgccactcccagccccatgttcaaacccatttttggggccccccct
aaaatggaaagtggggcttccttgccggctgccccttccaccaccacttctgtgtcttgt
agttctgtcctctccactgctcccagcacctccacaacaacctttaagcccatctttggt
aacatgggcccacctacatctgtgtccttggcctccacttcccccttcttgaaacaaccc
tcttctgtagcccccaccacaactgtcaccacagctgtccaggggcccctctttagtggc
ctccccaccatccagcccactgctgcacctgccaccaccgcctctgcctccgcctctgcc
accacctctgcctcatccagtgggaccactgactcaggctccaaacctaccttcagcttt
gggctgagcagcttggccagtgccacaaccagtgcccccgccaccacccccagcaccagc
agcacatcaactgctgccccctcgggatcccagcctttcctctttggagctgctcctgcc
cccagcgccagcttcaccccgtctactggctctgtattccagtttagtaagccctcggct
gctgttaccactgcagtagcagtcacaacctttggtgccacacagacggcccccagcagc
actgctggctttgggtttgggggcaccgtcagcacagcagccctgccgaccaccagccaa
gtgaccttgacatttggcccctccactaccaccacagcattcagcacccctttcagctcc
agcgtcaagacgctgccacccccaccctaccccggagccacatctcagcctgcttttggg
actgcagacgggcagcagcagcagcagcagcagcagcagcagcagcaggcagccaacaaa
gtgggccctgccacgagcttcagtagcacgttcaactttggaggttctacagccccaagc
ccggcccttgcccagccagcctttggtgggacaaagccactcacctcctttggggcccct
gccagcacgcagccagcctttggtggcaccaacacggtcttctcttttggcacaaccacc
acctccaacttcggggccaccacgcagaccaccagcagtggtactggcagttccatgttt
ggtggcatgaacctggcccctttcacatttgggagctccacagctgcaaccagcagtgga
ggctttggggtcagtgcagctgtccctggaaccagttcatccagtgcagccttcagcttt
ggagcaggccagagcggaacagccagtgccactgccccctttgggggttccttgaaccag
aaccccctaggtgccccaagtcaaagtgcaccctttgccttcagcgtggccaacaccccg
gagaacaagcctgtttttggaggcacttccacacctacctttggccagaatgctccaacc
cccggagcaggcacagtgggcagtagcctttcctttggggccccaagcaccccagcccag
ggctttgtgggagcagggccatcttttggaccatcgaccccttcgttttccattggtgca
ggatccaagacccctggggccaggcagcgactacaggcccggagacagcatactcgaaag
aaatag

DBGET integrated database retrieval system