KEGG   Monodelphis domestica (opossum): 100029605Help
Entry
100029605         CDS       T01031                                 

Gene name
NCOA3
Definition
(RefSeq) nuclear receptor coactivator 3
  KO
K11256  nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo01522  Endocrine resistance
mdo04915  Estrogen signaling pathway
mdo04919  Thyroid hormone signaling pathway
mdo05200  Pathways in cancer
mdo05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    100029605 (NCOA3)
   04919 Thyroid hormone signaling pathway
    100029605 (NCOA3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100029605 (NCOA3)
   05224 Breast cancer
    100029605 (NCOA3)
  Drug resistance
   01522 Endocrine resistance
    100029605 (NCOA3)
Enzymes [BR:mdo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100029605 (NCOA3)
Chromosome and associated proteins [BR:mdo03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100029605 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NCOA_u2 PAS_11 DUF4927 SRC-1 Nuc_rec_co-act DUF1518 PAS PAS_3 PAS_9 PAS_4 HLH
Motif
Other DBs
NCBI-GeneID: 100029605
NCBI-ProteinID: XP_016285096
Ensembl: ENSMODG00000016243
Position
1
AA seq 1406 aa AA seqDB search
MSGLGENSLDPLTTDSRKRKLPCDTPVQGLTSSGEKWRREQESKYLEELAELISANLSDI
DSFNVKPDKCAILKETVRQIRQIKEQGKAASIDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNRDGTIVFVSENVTQYLQYKQEDLVNTSVYSILHEDDRKDFLKNLPKSAVN
GDPWTSETPRQKSHTFNCRMLVKTVHDILDDVGNSPDMRQRYETMQCFALSQPRAMMEEG
EDLQSCMICVARRLTAVERVFPSNPESFITKHDLSGKVITIDTNSLRSSMRPGFEDIIRR
CIQRFFSLNDGQSWSQKRHYQEAYIQGHAETPVYRFSLADGTIVSAQTKSKLFRNPVTND
RHGFLSTHFLQREQNGYRPTSNPVGQNIRAPTVGCSSSVGGMNMSPNQSLPIQNRPYSLG
DPNAVGQMSGIRYGAPNNLNSINLGPGMQSSPYQNNNYGLTMNSPPHGSPGLGSNQQNIM
ISPRNRGSPKMPSHQFSPVPGMHSPMGSTSNTGGNSFSSSSLSALQAISEGVGTSLLSTL
SSPGPKLDNSPNMNINQQSKVGSQDSKSPVGLYCEQSQVESSICQVNSRDHPCDKDSKET
GVEGPENQRGPLESKGHKKLLQLLTCSSDDRGHSTLTNSPLDPGCKDSASSVTSPSGVSS
STSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSAASSEGIVK
QEQLSPKKKENNALLRYLLDRDDPNDSISKDMKPKVEGVDNKMGQCNSSSLPISNQEKEI
KVKTEQNEEVSGDLDNLDAILGDLTSSDFYNNAMSTNGNNLANKQQMYQGSTPLGLRSPQ
SLPSARPPFNRAVSLDSPIPVGSSPPVRNVNTFPMLPKQPVVSGNSRMMDTQENFTSNMG
MCLLGSYCNAFWKKNFLRTYMKCSYEIIVFFPSPSSPLHTSLLRCLPPPPPPFYNILLSR
LRLIEVKSFDQRYIASNKSRPGEIPMGMGVNAYGQTGPSITPGSWPDNMLTMDQGPRGTQ
NRALVRNSLDDLLCPPPNIEGQSDERALLDQLHTLLSNTDATGLEEIDRALGIPDLVNQG
QALEAKQESFQSQESAVMIDQKSALYGQSYQAQSAVIQGSFSSLQGQQQSFNTMMNQMSQ
QGNFPLQGIHPRANMMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALEMKMETPPTSGAT
VMRPVMQAQVNSQQQGFLNAQMVAQRSRELISHHIRQHRMAVMMQQQQQQQQTQQQQQTQ
AFSPPPNVTASASIDGALAGTPMPQAPPQQFSYPPNYGMSQQSDPAFSRVSSPPSAMMSA
RIGASQNPMMQHPQATPMYQSPEMKGWPSGTLSRNSSFPQQQFPPQGSPAPYSMMHMNGN
SGHIGQMNMNSMSMSGMPMGPDQKYC
NT seq 4221 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattaggagaaaactccttagatccactgactactgattctagaaaaagaaaa
ttgccatgtgatactcctgtacaaggtctgactagcagtggtgagaagtggcgccgggag
caagagagtaaatacctggaggaactggctgagttgatatctgccaatctaagtgacatt
gacagtttcaatgtcaaaccggataaatgcgcaattttgaaggaaactgtgagacagatc
cgacagataaaggagcaaggaaaggcagcttccattgatgatgatgttcagaaagctgat
gtatcttccacagggcagggagttattgataaagattccttaggaccacttttactgcag
gccttggatggttttctctttgtggttaatcgagatggaaccattgtatttgtgtcagaa
aatgtcacacagtatcttcagtataagcaggaggacttggttaataccagtgtctacagt
atcttgcatgaagatgacaggaaggattttctcaagaatttgcctaagtcagcagttaat
ggagatccatggacaagcgagacacctagacaaaaaagtcatacatttaattgccgtatg
ttggtgaaaacagttcatgatattctagatgatgtggggaacagtcctgatatgcgccag
agatatgagacaatgcaatgttttgctttgtctcagccacgtgctatgatggaggaggga
gaagatttacaatcttgtatgatctgcgtggcacgccgtctcactgcagtagaaagagta
tttccttcaaatcctgaaagctttattactaaacatgacctttcaggcaaagttattact
atagatacaaactcactgaggtcttctatgagacctggctttgaagatataatcagaaga
tgtatccagagattttttagccttaatgatggacagtcatggtcccaaaaacgacactat
caggaagcttatattcaaggacatgctgaaacccctgtgtatcggttctccttagctgat
gggactatagtgagtgcccaaacaaagagcaaactttttcggaatccagtaactaatgat
cgccatggctttctttctacccacttcctacagagagagcagaatggatatcgacctact
tctaacccagtgggacaaaacatacgagctcctacagttggatgttccagttctgttgga
ggaatgaatatgtcaccaaatcaaagcttgcccatacagaataggccctactccttggga
gatcccaatgcagtaggacagatgagtggcattagatatggagcccctaacaacttaaac
tctataaatcttgggccaggaatgcaatcctctccctatcagaacaataattatgggcta
actatgaacagtcccccacatggtagccctggccttggctccaatcagcagaacattatg
atttctcctcgaaacagaggtagtccaaagatgccttcacatcagttttctcctgttcca
ggtatgcattctcctatgggatctaccagcaacactgggggcaacagtttctctagtagt
tccctcagtgccctccaagccatcagtgagggtgtgggaacttcgcttttgtctacactt
tcttcaccaggccccaagttggataattctccaaatatgaacatcaaccagcaaagtaaa
gtaggcagtcaggattctaagagtcctgttggcttgtattgtgaacagagtcaggtggaa
agttccatatgccaagtcaatagcagggaccacccttgtgataaagacagtaaagaaact
ggtgttgaagggccagagaatcagaggggaccacttgaaagcaaaggccataaaaaatta
cttcagttactaacatgctcttcagatgaccgggggcactccactctgacaaattctcca
ttggatccagggtgtaaagattctgcttccagtgtcactagtccttctggagtctcgtct
tctacatctgggggagtttcttccacatcaaatatgcatgggtccctgttgcaagagaaa
catagaattttgcacaagctactccagaatgggaattctcctgctgaagtagccaagatt
acagctgaagcaactgggaaagacacgagcagtgcggcttctagtgaaggaatagttaag
caggagcagctaagtcccaagaagaaggaaaacaatgcacttcttcgctatctgcttgat
agggatgatcctaatgattcaatttctaaagacatgaaacccaaagtggaaggcgttgat
aataaaatgggacagtgcaacagctcttctcttcctatttcaaatcaagaaaaagagatt
aaagttaagactgaacagaatgaagaggtgagtggagacttggataatttagatgctatt
cttggtgatctgacaagttctgacttttataataacgccatgtctacaaatggtaataac
ctggcaaataagcaacagatgtatcaaggaagtacccctctaggtttgagaagcccacag
tctctgccatctgctcgtcctccttttaatcgagctgtatccttggatagtcctattcct
gttggttcaagtcctccagtgagaaatgttaatacatttcccatgttaccaaagcagcct
gtggtaagcggaaattcaaggatgatggacacccaggagaattttacctctaatatgggt
atgtgcttacttgggagttattgtaatgcattttggaaaaagaactttttaaggacctat
atgaaatgttcctatgaaataatagtgttttttccctccccttcttctcccctccatact
tccctcttgagatgtctccctccaccaccacctccattttataatattttacttagcaga
ctgaggctgatagaggtcaaatcatttgaccagaggtacatagctagtaataagtcaagg
cctggtgagattcctatgggcatgggagtaaatgcctatggccagacaggaccttctatc
acccctggatcttggcctgataatatgttaaccatggaccagggccctcgtgggacacaa
aatagagcccttgttaggaattccctggatgatctcttatgtcctcctcctaacatagaa
ggtcagagtgatgaaagagctcttttggatcagttacatactctcttgagtaatacagat
gccacaggacttgaagaaattgatagagctttaggaatcccagatcttgtcaatcaagga
caagctttggaagctaaacaggagtcttttcaaagtcaagaatctgctgtaatgattgac
caaaagtctgctctatatggacagtcttatcaagcccagtctgcagtaattcaaggcagt
ttcagtagtcttcagggacaacagcaatcatttaatacaatgatgaatcaaatgagccag
cagggtaactttccactacagggaatacatcccagagctaacatgatgagaccccgaaca
aatactcccaaacagcttagaatgcagctccagcagagactacagggtcagcagtttttg
aaccagagccgtcaggcccttgaaatgaagatggaaacccctccgactagtggggctaca
gtgatgaggcctgtaatgcaggctcaagtgaattctcagcagcaaggttttctcaatgct
cagatggtggcccagcgcagcagagagctaattagtcaccacatccgacagcaccggatg
gctgtgatgatgcagcaacagcaacagcagcaacagacgcagcagcagcagcagacacag
gcttttagccctccccctaatgtgactgcttcggccagcatagacggggctttggccggg
acaccgatgccacaagctcctccacagcagttttcttacccaccaaattatggaatgagc
cagcaatcagatcctgcctttagcagagtatctagtcctcctagtgcaatgatgtcagca
agaatcggtgcctcccagaaccccatgatgcaacaccctcaggccacaccgatgtaccag
tccccagaaatgaaaggctggccatcaggaaccttgtccaggaacagttcatttccacag
cagcagtttcccccccagggtagtcctgccccctacagtatgatgcacatgaatggcaac
agtggccacatcggacaaatgaacatgaattccatgtccatgtctgggatgcccatgggc
ccagatcagaaatactgctga

DBGET integrated database retrieval system