KEGG   Monodelphis domestica (opossum): 100029871Help
Entry
100029871         CDS       T01031                                 

Definition
cytochrome P450 1A1-like
Orthology
K07408  
cytochrome P450, family 1, subfamily A, polypeptide 1 [EC:1.14.14.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Ovarian steroidogenesis
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100029871
  Amino acid metabolism
   00380 Tryptophan metabolism
    100029871
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100029871
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100029871
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    100029871
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100029871
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100029871
Cytochrome P450 [BR:mdo00199]
 Cytochrome P450, animal type
  CYP1 family
   100029871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 516 aa AA seqDB search
MMTSILSLLGFSKSFTVTELLVVSAVFCLVFWIIDSYHQRVPKGFKSPPGPWAWPLIGNV
LTLGKNPHLVLTQMREKYGDVMQIQIGSTPVLVLSGLETIRHALVKQGDDFKGRPDLYSF
SLILDGESLSFGPDSGEVWAARRKLTQNALKAFSISSSPSSSFCYLEEHVIKEAEYLIQK
FQEQKGHFDPVRYIVVSVANVICAICFGQRYDHDDQELLNIVRLSNKFGEVAASGNPVDF
IPILRYLPNSKITAFRDLNEKIVAFTQKLVKEHYRKFEKGCIRDITDSLIEHCQEKKLDE
NANIMLSEKKVVNVVIDLFGAGFDTVTTAISWGLMYLVAKPEVQKKIHEELDTVIGRERL
PQLSDKTQLPYMEAFILETFRHSSFLPFTIPHSTTRDITLNGFYIPKGRCVFVNQWQINH
DPKIWGDPSVFRPERFLSVDGTINKALSEKVIMFGLGKRKCIGETIARWEVFLFLSILLH
RMEFSVPSGVKVDLTPVYGLTMKHIPCEHFQTKLRS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaagtatactttccttattgggattctccaaatccttcactgtcacagagctc
ctagtggtttctgctgtcttctgcctggtcttctggatcattgactcttaccatcaaagg
gtccccaagggatttaaaagcccacctggcccctgggcttggcctctgattggcaatgta
ttgactctggggaagaatccccacttggtcctgacccaaatgagagagaagtatggggat
gtgatgcaaattcagattggctccaccccagtgctcgtgctgagtggtttggaaaccatc
cggcatgccctggtgaagcaaggggatgacttcaagggccggcctgacctctacagcttc
tccttaatcctggatggagagtccttgtcttttggacctgactcaggggaggtatgggcc
gctcgaaggaagctgacccagaatgctctgaaggccttctccatttcctcttccccatct
tcttccttttgctacctggaggagcatgtgatcaaggaggctgaatacttgatccagaag
ttccaggagcagaagggacactttgaccccgttaggtacatagtggtatctgtggccaat
gtcatctgtgccatctgctttggacagcgctatgaccatgatgaccaagagttacttaat
attgtccgcctgagcaataaatttggtgaagtcgctgcctctgggaatccagttgatttc
atccctatactccgataccttcccaacagcaagataacagccttccgggatctgaatgaa
aaaattgttgcgttcacacaaaaactggtgaaggaacattacaggaagtttgagaagggt
tgcatccgggacatcacagacagcctaattgaacattgccaagaaaagaagttggatgag
aatgccaacatcatgctgtcagaaaagaaggttgtcaacgttgtcatagacctctttgga
gccggctttgacactgtcaccacagctatttcctggggtctcatgtaccttgtagcaaag
cctgaggtccagaagaagatccatgaggagctggacacggtgattggcagagagcggttg
ccccagctctcagacaaaactcagctcccctacatggaagccttcatccttgaaaccttc
aggcattcttccttcctccccttcaccattccccacagcacaaccagagacataaccttg
aatggcttctacattcccaagggacgctgcgtctttgtgaatcaatggcagattaaccat
gacccgaaaatatggggagacccatcagtgttccgaccagaaagattcctcagtgtagac
ggaactatcaacaaggccctgagtgagaaggtgattatgtttggcctggggaaaaggaag
tgcatcggagagaccattgctcggtgggaagtcttccttttcctgtccatcctattgcat
cggatggagttcagtgtcccctctggagtgaaagtggacctgacccctgtctatgggttg
acaatgaagcacatcccctgtgagcattttcagacaaagttgcgatcttag

DBGET integrated database retrieval system