KEGG   Monodelphis domestica (opossum): 100029907Help
Entry
100029907         CDS       T01031                                 

Definition
lactosylceramide alpha-2,3-sialyltransferase-like
Orthology
K03370  
lactosylceramide alpha-2,3-sialyltransferase (sialyltransferase 9) [EC:2.4.99.9]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:mdo00604]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 648 aa AA seqDB search
MGWSAEQALGRPPGSIENVSCHDDDRNHDCLRARDSFAFLLGSRPGAKAAAAEWNALLSS
PSGSRPRPQHRLGRRLWPRHLQTEVGGVLASEPGSRLGRSCSPGRSRQSPGPTLSRQPCP
QRARPGFVRPWATRDPRGVVARERRGEGKKGSGASSVRGSWLVPSPPPPPSARASPTPSP
LPFPLPPPPLGASLSPCAGAAVVVVQATAASRPGLNDKECRQRAAVGYAGQFSALWWTPQ
FKNQPDLDRGEEMSRDGDTMPTEHNYLKLKSDCPPILPCYVPPPKKMRRFNLLLKDFLKC
FLIVFGVWILYILKLNFTTEECDMKGAHHVDPKRVKRAQNYARQVLQGECRPDFAKKEMH
RLFAQQYDVNASPFINENMELEEDLYRYDPPFGFRKFSYKLQSLLKLLPEHGLPENLKAK
PCKHCVVMGNGGVLNGLGLGHILNQFDVVIRLNSAPVQGYTDHVGNKTTIRMTYPEGAPL
SDLEYYSNDLFVTVLFKSVDFNWLEAMLKNETMPLWVQLFFWKHVAEKIPLQSKQFRILN
PVIIKNTAIDMLHYSEPQPRIWGWSKNVPTMGVVAVVLATHLCDEVSLAGFGYDLSRPKT
PLHYFDNLCMAAMNIQTMHNLTTETRFLQKLVKEGIVKDLSGGIHCEF
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgggatggtctgcagagcaagccctcggccgtcctccaggttctatagaaaatgtcagc
tgtcacgatgacgaccgcaaccacgactgtctcagggcccgtgactccttcgcgtttctc
ctgggaagcaggccaggggccaaggcggcggcggcagagtggaacgctctcctcagcagc
ccatctgggagccggccccgaccccagcatcggctcgggaggaggctgtggccccgacac
ctgcagacagaggtgggtggtgtcctcgcgagcgagccgggtagcaggcttggccgctcc
tgctctcccggccgcagccgtcagtcgcccggccccacgctgagccgtcagccctgcccg
caacgcgcgcggccgggctttgtgcgtccttgggcgaccagggatccccgcggggtcgtg
gcgagggagaggagaggagagggaaagaaggggagcggagctagctcagttcgaggctcc
tggctcgtgccctccccgcccccgccgccttctgcgcgcgcctcccccactccttctccc
ctcccttttcctctcccccctcctcccctgggcgcctcgctctccccgtgtgccggagcc
gcggtggttgtagtgcaagcgactgcagcatcacggccggggctgaatgacaaagagtgc
cgacaacgggctgctgtgggctacgcggggcagttcagtgctctgtggtggacgccacag
tttaagaaccagccagatctggacaggggagaagagatgagcagagatggagatacaatg
ccaacagaacataactatttgaaactgaagagcgattgccctcctatcctgccatgttat
gtcccacctccaaaaaagatgagaagattcaacctattattgaaagacttcctcaaatgt
ttcctaattgtgtttggagtgtggatcctttatatcctcaaattaaattttactaccgaa
gaatgtgacatgaaaggagcccatcatgtggatcccaagcgggtaaagagagctcagaac
tacgctcgccaggtattgcaaggggagtgccgacccgactttgcgaaaaaggagatgcac
cggctatttgctcagcaatacgacgtgaatgcgtcgcctttcatcaatgaaaacatggaa
ctggaggaagacttgtatagatacgaccctccctttggcttccgcaagttctcctataaa
cttcagagccttctaaaacttttacctgaacatggtttgccagaaaacttgaaagcaaaa
ccttgtaaacactgtgtggttatgggaaatggtggcgtcctgaatggcctcggactgggc
cacatactgaatcagttcgatgttgtgatcaggttaaacagtgcaccagttcagggatat
acagatcatgttgggaataaaactaccataaggatgacttatccagagggagctccattg
tctgacctcgagtattattctaatgatttgtttgttactgttttatttaagagtgttgac
ttcaactggcttgaagcaatgttaaaaaatgaaacaatgccactttgggtacagctgttc
ttttggaagcacgttgctgagaaaatacccctccaatcaaagcagtttcggattctgaat
ccagtgatcattaaaaacacggccatcgacatgcttcactactcagaacctcaacccaga
atctggggctggagtaagaatgtgcccaccatgggggtcgttgctgttgtcctggccact
catctgtgcgatgaagtcagtttggcaggttttggctatgatctcagtcggcccaaaacc
ccgttacactactttgacaatctctgcatggcagcgatgaacatacaaaccatgcacaac
ctgacaacagaaaccagatttctacaaaagctggtgaaagaagggattgtgaaagacctg
agtggaggaatacactgtgaattctga

DBGET integrated database retrieval system