KEGG   Monodelphis domestica (opossum): 100029908Help
Entry
100029908         CDS       T01031                                 

Definition
(RefSeq) cytochrome P450 1A2
  KO
K07409  cytochrome P450 family 1 subfamily A polypeptide 2 [EC:1.14.14.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00140  Steroid hormone biosynthesis
mdo00232  Caffeine metabolism
mdo00380  Tryptophan metabolism
mdo00591  Linoleic acid metabolism
mdo00830  Retinol metabolism
mdo00980  Metabolism of xenobiotics by cytochrome P450
mdo00982  Drug metabolism - cytochrome P450
mdo01100  Metabolic pathways
mdo05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100029908
   00591 Linoleic acid metabolism
    100029908
  Amino acid metabolism
   00380 Tryptophan metabolism
    100029908
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100029908
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100029908
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100029908
   00982 Drug metabolism - cytochrome P450
    100029908
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100029908
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100029908
Cytochrome P450 [BR:mdo00199]
 Cytochrome P450, animal type
  CYP1 family
   100029908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100029908
NCBI-ProteinID: XP_007478229
Position
1
AA seq 517 aa AA seqDB search
MVSSLLASISISELLLASVIFCLVFWVTRSSHQRVPKGLKSPPGPWAWPLFGNVWTLGKN
PHLTLAQLSEKYGDVMKIHIGSTPVIVLSGLETIRQALVKQGEDFKGRPDLYSSTFVADG
YSLAFNPDSGEVWAVRRKLAQNALNTFSVSSSPSSSSCYLEEHVNKEVKHLIQKFQELME
GVGCFDPYRHIVASVANVISAMCFSQRYEDHKNPEFTTLINASHEFVESATSGNPVDFFP
ILRYIPNPQLQRFKEFNQRFLKFLQNTIREHHKAFDENNIQDITGALYKHSQDKAFGNTS
SSVPEMLIINLINDIFGAGFDTVTTAISWSLMYLVTNPKVQKKIQQELDTVIGRDRWPLL
SDRPQLPFMEAFILEIFRHTSFVPFTIPHSTTRATTLNNFYIPKGTCVFVNQWQTNHDPK
LWEDPSVFRPERFLSADGTVNKALSEKVILFGLGKRRCIGETIARWEVFLFLAILLHQIE
FSVPSGVKVDMTPTYGLTMKHPRCEHFQARPRFSRKG
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggtatcaagcttgttggcttccatctctatttcggagctgctcttggcttctgttatc
ttctgcctggtcttctgggtcactaggtcttcccatcaaagggtacctaagggactcaaa
agcccacctggaccctgggcttggcctctgtttggtaatgtatggactctggggaagaat
ccccacttgaccttagcccaactgagtgagaagtatggggatgtgatgaagattcatatt
ggttctacccctgtgattgtgctgagtggcctggaaaccatccggcaggccctggtgaag
cagggggaggacttcaaggggagacctgacctttacagctccacctttgttgcagatggt
tacagcctggccttcaaccccgactcaggggaagtatgggcagttcggaggaagctggcc
cagaatgctcttaataccttctctgtgtcctcttctccatcctcttcctcctgctacctg
gaggagcatgtgaacaaggaggttaaacatttgatccagaaattccaggagctgatggag
ggggtaggatgctttgacccctacaggcatatagtagcatctgtggccaacgtcatcagt
gccatgtgttttagccaacgctatgaggaccacaagaacccagaatttacgactcttatt
aacgcaagccatgagtttgttgagagtgccacctcaggcaacccagttgacttcttcccc
atccttcgctacatcccaaatcctcagttgcagaggttcaaagagttcaaccagaggttc
ctaaaattcttgcagaataccattcgtgagcatcacaaggcctttgatgagaacaatatt
caagacatcactggggctctgtacaaacacagccaagataaggcttttgggaacaccagc
tccagtgtgccagaaatgctgatcatcaatctcatcaatgacatctttggagcgggcttt
gatacagtcaccacggccatctcctggagtctcatgtacctggtgacaaaccctaaggtc
cagaagaagatccagcaggagttggacacagtgattggaagagatcgatggcccctactc
tcagacagacctcagctgcctttcatggaggcctttatcctggaaatcttcagacatacc
tcctttgtccctttcaccattccccacagcacaacgagagccacaacactaaacaacttc
tatatccccaaggggacctgtgtttttgtgaaccagtggcagactaaccatgacccgaaa
ctatgggaggacccatcggtgttccggccagagagattcctcagtgcagatggaactgtc
aacaaggccctgagtgagaaggtgattttgtttggcctgggaaaaagaagatgcatcggg
gagaccattgcccggtgggaagtcttcctcttcctggccatcctgctgcatcagatagag
ttcagtgtcccttctggtgtgaaggtggatatgaccccaacttatggactgaccatgaaa
catccccgttgtgagcacttccaggcccggccacgcttctccaggaagggttga

DBGET integrated database retrieval system