KEGG   Monodelphis domestica (opossum): 100029908Help
Entry
100029908         CDS       T01031                                 

Definition
cytochrome P450 1A2-like
Orthology
K07409  
cytochrome P450, family 1, subfamily A, polypeptide 2 [EC:1.14.14.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Steroid hormone biosynthesis
Caffeine metabolism
Tryptophan metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100029908
   00591 Linoleic acid metabolism
    100029908
  Amino acid metabolism
   00380 Tryptophan metabolism
    100029908
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100029908
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100029908
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100029908
   00982 Drug metabolism - cytochrome P450
    100029908
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100029908
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100029908
Cytochrome P450 [BR:mdo00199]
 Cytochrome P450, animal type
  CYP1 family
   100029908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 517 aa AA seqDB search
MVSSLLASISISELLLASVIFCLVFWVTRSSHQRVPKGLKSPPGPWAWPLFGNVWTLGKN
PHLTLAQLSEKYGDVMKIHIGSTPVIVLSGLETIRQALVKQGEDFKGRPDLYSSTFVADG
YSLAFNPDSGEVWAVRRKLAQNALNTFSVSSSPSSSSCYLEEHVNKEVKHLIQKFQELME
GVGCFDPYRHIVASVANVISAMCFSQRYEDHKNPEFTTLINASHEFVESATSGNPVDFFP
ILRYIPNPQLQRFKEFNQRFLKFLQNTIREHHKAFDENNIQDITGALYKHSQDKAFGNTS
SSVPEMLIINLINDIFGAGFDTVTTAISWSLMYLVTNPKVQKKIQQELDTVIGRDRWPLL
SDRPQLPFMEAFILEIFRHTSFVPFTIPHSTTRATTLNNFYIPKGTCVFVNQWQTNHDPK
LWEDPSVFRPERFLSADGTVNKALSEKVILFGLGKRRCIGETIARWEVFLFLAILLHQIE
FSVPSGVKVDMTPTYGLTMKHPRCEHFQARPRFSRKG
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggtatcaagcttgttggcttccatctctatttcggagctgctcttggcttctgttatc
ttctgcctggtcttctgggtcactaggtcttcccatcaaagggtacctaagggactcaaa
agcccacctggaccctgggcttggcctctgtttggtaatgtatggactctggggaagaat
ccccacttgaccttagcccaactgagtgagaagtatggggatgtgatgaagattcatatt
ggttctacccctgtgattgtgctgagtggcctggaaaccatccggcaggccctggtgaag
cagggggaggacttcaaggggagacctgacctttacagctccacctttgttgcagatggt
tacagcctggccttcaaccccgactcaggggaagtatgggcagttcggaggaagctggcc
cagaatgctcttaataccttctctgtgtcctcttctccatcctcttcctcctgctacctg
gaggagcatgtgaacaaggaggttaaacatttgatccagaaattccaggagctgatggag
ggggtaggatgctttgacccctacaggcatatagtagcatctgtggccaacgtcatcagt
gccatgtgttttagccaacgctatgaggaccacaagaacccagaatttacgactcttatt
aacgcaagccatgagtttgttgagagtgccacctcaggcaacccagttgacttcttcccc
atccttcgctacatcccaaatcctcagttgcagaggttcaaagagttcaaccagaggttc
ctaaaattcttgcagaataccattcgtgagcatcacaaggcctttgatgagaacaatatt
caagacatcactggggctctgtacaaacacagccaagataaggcttttgggaacaccagc
tccagtgtgccagaaatgctgatcatcaatctcatcaatgacatctttggagcgggcttt
gatacagtcaccacggccatctcctggagtctcatgtacctggtgacaaaccctaaggtc
cagaagaagatccagcaggagttggacacagtgattggaagagatcgatggcccctactc
tcagacagacctcagctgcctttcatggaggcctttatcctggaaatcttcagacatacc
tcctttgtccctttcaccattccccacagcacaacgagagccacaacactaaacaacttc
tatatccccaaggggacctgtgtttttgtgaaccagtggcagactaaccatgacccgaaa
ctatgggaggacccatcggtgttccggccagagagattcctcagtgcagatggaactgtc
aacaaggccctgagtgagaaggtgattttgtttggcctgggaaaaagaagatgcatcggg
gagaccattgcccggtgggaagtcttcctcttcctggccatcctgctgcatcagatagag
ttcagtgtcccttctggtgtgaaggtggatatgaccccaacttatggactgaccatgaaa
catccccgttgtgagcacttccaggcccggccacgcttctccaggaagggttga

DBGET integrated database retrieval system