KEGG   Monodelphis domestica (opossum): 100029977Help
Entry
100029977         CDS       T01031                                 

Gene name
AOX1
Definition
aldehyde oxidase 1 (EC:1.2.3.1)
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100029977 (AOX1)
   00350 Tyrosine metabolism
    100029977 (AOX1)
   00380 Tryptophan metabolism
    100029977 (AOX1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100029977 (AOX1)
   00760 Nicotinate and nicotinamide metabolism
    100029977 (AOX1)
   00830 Retinol metabolism
    100029977 (AOX1)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100029977 (AOX1)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100029977 (AOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 1345 aa AA seqDB search
MSFALNGPSELLFYVNGRKVTEKNADPETMLLSYLRKKLHLTGTKYGCGGGGCGACTVMI
SRCDPGTKKIRHYSANACLLSICSLYGAAVTTVEGIGSTKTRLHPVQERIAKCHGTQCGF
CSPGMVMSLYSLLRNISEPSMDQLMEALGGNLCRCTGYRPIVDACKTFCKATDCCQSKEN
GICCLDQEENELLDSEQGNRTCQKPFQEEEFLPLDPTQEFIFPPELMMMAEKQPKITRVF
YGERITWISPVTLRDLLEVKAKYPDAPIVMGNTTVGPNMKFKGIFHSVIISPDRIAELNA
VNYTDNGLTIGAGCSLAQLKDVLTDMILELPGEKTQTYRALLKHLKTLAGSQIRNVASLG
GSVISRHSTSDLNPLLAVGNCTLNLASKDGKRQIPLNNQFLMRVRSSDLRPEEILISVNI
PYSRKWEFVSAFRQAPRQQNALAIVNSGMRVLFEEDTNIIRDICIFYGGISSTTVCAKKS
CQKLIGRAWNEEMLGDACRLVLEELFLPASALGGKVEYKRSLIVSFLFKFYIEVLQVLKM
MVSLNPALGPYLPSEYGSVLEDFHSKHYETVLRYQKVDTKQFPQDPIGRPIMHLSGIRHA
TGEAIYCDDMPALEQELFLAFVTSSRAHAKIVSIDTSEALKLPGVIDVLTGKDLQDVNSF
RDFLETEEILATNEVFSVGQLVCAVVADSDVQAKRAAHLVKIEYNDLKPLILTIEDAIQH
NSFYEPERKIEYGNVDEAFKTVDQILEGEIHIGGQEHFYMETQSMLVVPHGEDKDMDIYV
STQNPRLAQDIVASILRVPSNKIMCHVKRVGGAFGGKSIKTSILAAITAFAASKTGRPVR
CILERGEDILITGGRHPYLGKYKVGFMNDGRIMALDVVHYANGGFMLDESVFVVEMGILK
LDNAYKIPNLRCRGLACKTNLPSNTAFRGFGYPQAALITESCMTKVAAQSGLPPEKVRMI
NMYKEMDETHYKQEIDAKNLIKCWNECMEISSYYRRKAMVEDFNKKNYWKKKGIALIPMK
FPIGLCSLAAGQAAALVHIYLDGSVLVTHCGIEMGQGVHTKMIQVVSRELGMPMDNIHLR
GTSTETIPNGNVSGGSVVADLNGLALKDACQILRKRLEPIISKNPYGTWKEWAQEAFNQS
ISLSATGYFRGYESNMDWEKGEGHLFHYCVYGTACSEVEIDCLTGDHKNIRTDIVMDIGH
SINPALDIGQVEGAFIQGVGLYTLEELKYSPEGILYTRGPEQYKIPSFCDVPSELNISFL
PPSKVAHTLYSSKGLGESGLFLGSSVFFALHDAILAARQERGFSGVFTLNSPLTPEKIRM
ACEDKFTKMIPKDEPGSYVPWDIRV
NT seq 4038 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgccttaaacgggccatcggaactgcttttctatgtgaatggcagaaaggta
actgagaagaatgcagatcctgaaacaatgttgttatcatacttgaggaagaaactccat
ctgacaggaacaaaatatggctgtggtggaggtggctgtggagcctgcacggtgatgata
tcaagatgtgaccctggaactaaaaaaataagacattattcggccaatgcctgccttctt
tctatatgctctctgtatggggctgctgtcaccacagtagaaggcataggaagtaccaaa
accaggcttcatccagttcaggaaagaattgccaaatgtcatgggactcagtgtggattc
tgtagccctgggatggtgatgtctttgtactctcttttgagaaacatttcggaaccctca
atggatcagttaatggaagctcttggaggtaatttgtgtcgttgcactggatatcggccc
atagtagatgcctgcaagactttctgtaaagctactgattgctgccagagtaaggaaaat
ggcatctgctgcttggatcaagaagaaaatgaattgctagattctgagcaaggaaatagg
acatgtcaaaaaccctttcaagaagaagagtttctgccattggatcctactcaggaattt
atatttccccctgaactaatgatgatggctgagaagcagcctaaaataactagggttttc
tatggggaacggataacctggatttctcctgtaacactaagagatcttctggaagtgaaa
gccaagtatccagatgcaccaattgtcatgggaaacaccactgtgggacctaatatgaag
ttcaaagggatttttcattctgttatcatttctcctgatagaattgcagaactgaatgct
gtaaattatacagacaatggattgacaataggtgctggctgtagcctagcccagttgaaa
gatgtccttactgatatgatcttggagcttccaggagagaagacacagacataccgagct
ctcttaaagcatctgaagactctggcaggatcacagatcaggaatgtggcatctttaggg
ggcagtgtcatcagtagacattcaacatcagatctgaatccccttctggctgtgggtaac
tgtacccttaatctggcttcgaaagatggaaagcgacaaattcctttgaataaccaattt
cttatgagagtaagaagttcagatctcagacctgaagaaatcttgatctcagtgaacatt
ccctattctagaaagtgggaatttgtctcagcctttcgacaagctccacgtcaacaaaat
gccttggcaattgtcaattctggaatgagagtcctttttgaagaagatacaaatatcatt
agggatatctgtattttctatggtggcattagctcaaccactgtatgtgctaagaaatct
tgccagaaactcataggaagagcttggaatgaggagatgctgggtgatgcttgtcgactg
gttctagaggaacttttcctcccagcctcagcacttggtggaaaggtggaatacaagagg
tccctcattgtcagttttcttttcaaattctacatagaagtgttgcaggttttgaagatg
atggtaagtttaaaccctgctcttggtccttatttaccctctgagtatggaagtgtttta
gaagatttccattctaaacattatgagaccgttttaaggtaccagaaggtagatactaaa
caatttcctcaagatccaattgggcgtcccatcatgcacctttctggtattagacatgca
acgggtgaagccatttattgtgatgacatgcctgcactggagcaagaacttttcttggcc
tttgtaacaagttcaagggctcatgctaagattgtgtctattgatacatcagaggctctt
aaattaccaggagtaattgatgttctgacaggtaaagatcttcaagatgtaaactccttc
agggattttcttgagactgaggaaatattggcgactaatgaggtctttagtgtgggccag
cttgtgtgtgccgtagttgctgattcagatgttcaggcaaagcgagcagctcatctggtg
aagattgagtataatgatttgaaacccttgatcctgactattgaggatgctatacagcat
aactctttctatgagccagaaagaaaaatagaatatggaaatgttgatgaagcatttaaa
accgttgaccaaatccttgaaggtgagatccacattggaggtcaagaacatttttacatg
gaaactcaaagcatgcttgttgtcccacatggagaggataaagacatggatatctatgtg
tcaacacaaaatcctagattagcacaggacatagtagcttccatattaagggttccatct
aacaagatcatgtgccatgtcaaacgagttggtggagcatttggtggaaaatcaataaaa
actagtatcttggcagctattacagcatttgcagcaagcaaaactggtcgtccagttcgt
tgcattttggaacgtggagaagatatattaataactggaggtcgtcatccttaccttgga
aagtacaaagtaggattcatgaatgatggtagaatcatggccctcgatgttgtacattat
gctaatggtggcttcatgttggatgaatctgtatttgtagtagagatgggcatcctaaag
ttggacaatgcctacaagatcccaaacctgcggtgccgaggtcttgcttgcaaaacgaat
ctgccttccaataccgctttccgtggatttggctatccccaagcagcactgattacagaa
tcgtgtatgacaaaagttgctgcccaaagtggtttgcccccagagaaggtgagaatgata
aacatgtacaaagaaatggatgaaacacattataaacaggagattgatgcaaagaatcta
ataaaatgttggaatgaatgcatggagatatcctcatactacagaaggaaagcgatggta
gaagatttcaacaagaagaattattggaaaaagaaaggcattgcacttattccaatgaaa
tttcctattggtctttgctcacttgctgctggtcaggcagctgctctagttcacatctat
ctagatggatctgtgctagtaacccactgtggaatcgaaatggggcaaggagttcacact
aaaatgattcaggttgtcagtcgtgagttagggatgccaatggacaatattcatttgcgg
ggaacaagtactgaaaccatccctaatggaaatgtctctgggggatctgtggtggcagat
ctcaatgggctggcactgaaggatgcttgtcaaattcttcgaaagcgtctggagcccatc
attagcaaaaacccttatggcacatggaaggagtgggcacaagaagcttttaatcaaagc
attagtctttcagcaactggatatttcaggggctatgagtcaaacatggactgggaaaaa
ggcgaaggtcacttatttcactactgcgtgtatggaactgcctgttcagaagttgaaatt
gactgcctgacaggagatcataagaatataagaacagacattgtcatggatattggccac
agtatcaatccagctcttgatatagggcaggttgaaggtgcatttattcaaggtgttggt
ctttatacactagaggaactgaaatactcacctgaaggaattttgtacactcggggacca
gaacaatataaaatcccttctttctgtgatgttccttctgaactcaatatttcctttttg
cctccttctaaagttgctcacactctatattcatcaaagggcttgggtgaatccggatta
ttcctgggatcctctgtgttttttgctctacatgatgccattcttgcagcacgacaagaa
agaggattttctggagtcttcacactgaatagtccattgacccctgagaagattagaatg
gcttgtgaagataaatttacaaaaatgattccaaaggatgaacctggatcttatgttcct
tgggatattcgtgtatga

DBGET integrated database retrieval system