KEGG   Monodelphis domestica (opossum): 100030012Help
Entry
100030012         CDS       T01031                                 

Gene name
MOS
Definition
v-mos Moloney murine sarcoma viral oncogene homolog
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100030012 (MOS)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100030012 (MOS)
  Cell growth and death
   04114 Oocyte meiosis
    100030012 (MOS)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100030012 (MOS)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100030012 (MOS)
Protein kinases [BR:mdo01001]
 Serine/threonine protein kinases: Other group
  MOS family
   100030012 (MOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 351 aa AA seqDB search
MPSPVPLARYLPREFSPSVDLRPCSSPLELPGKRGKLFLEGTPSPRARRLPRRLAWCSID
WDQLCFLRKLGTGGFGSVYKGTYRGLTVAIKQVKKCNKNRLASRQSFWAELNVARLCHKN
VVRVLAASTCTPRGYNSLGTIIMEYWGHTTLYDVIYGASSAPDNESSAEEPLDLGRCLQY
SLDVVNGLLFLHSQGIVHLDLKPANILIGEQEICKIGDFGCSQKLEDLLGLSSHHCHLGG
TYTHRAPELLKGEAVTDKADIYSFAITLWQMVTKEVPYSGDHQYILYAVVAYNLRPALTS
SVFTDSLPGQRLEHIIQCCWTADTLVRPSSDLLLGDLNSLHANLADLNARS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgcccgttcccttggcccgttatttacctagagagttttctccgtccgtggac
ttgcggccctgcagcagccccctggagctccccgggaagaggggcaagctctttttagag
ggaactccctccccccgggctcggaggctgccccggaggctggcctggtgttccattgac
tgggatcagttatgctttctgcggaagctggggactggggggtttggctcggtctataag
ggcacataccgagggctcacggtcgcgatcaaacaagtgaagaagtgcaacaagaaccgg
ctagcttcccggcagagcttctgggccgagctcaatgtcgccaggctgtgccataaaaat
gtggtgcgagtcttggccgccagcacttgcactccccggggttacaacagcctagggacc
atcatcatggagtactgggggcacactaccctttacgacgtcatctacggggctagctcc
gcgcccgacaacgagtccagcgccgaggagcccttggacttgggaagatgcctccagtat
tccctggacgtggtcaacggcctgcttttcctccactctcaaggcatagtccacttggat
ctcaagccggccaacatcttgatcggggagcaagagatctgcaaaattggggactttggg
tgttcgcaaaagctagaggatctgctgggtctgagctcgcaccattgccacctgggcggt
acatacacacaccgcgccccagagctcctcaaaggagaggcggtgactgacaaagcagat
atttattcttttgccatcacgctctggcaaatggtcacaaaggaagtgccttattcaggc
gaccaccaatacatactctatgctgtggtggcttataacctccggccagcgctcacatcc
tctgtcttcactgactccttacctggccagagactggaacacattatccaatgttgctgg
accgctgacacattggtcagacccagctcagacctgctcctgggtgatcttaattccttg
cacgctaacttggcagacttgaatgctagaagttaa

DBGET integrated database retrieval system