KEGG   Monodelphis domestica (opossum): 100030012Help
Entry
100030012         CDS       T01031                                 

Gene name
MOS
Definition
(RefSeq) MOS proto-oncogene, serine/threonine kinase
  KO
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100030012 (MOS)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100030012 (MOS)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100030012 (MOS)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100030012 (MOS)
Protein kinases [BR:mdo01001]
 Serine/threonine kinases: Other
  MOS family
   100030012 (MOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
3
AA seq 351 aa AA seqDB search
MPSPVPLARYLPREFSPSVDLRPCSSPLELPGKRGKLFLEGTPSPRARRLPRRLAWCSID
WDQLCFLRKLGTGGFGSVYKGTYRGLTVAIKQVKKCNKNRLASRQSFWAELNVARLCHKN
VVRVLAASTCTPRGYNSLGTIIMEYWGHTTLYDVIYGASSAPDNESSAEEPLDLGRCLQY
SLDVVNGLLFLHSQGIVHLDLKPANILIGEQEICKIGDFGCSQKLEDLLGLSSHHCHLGG
TYTHRAPELLKGEAVTDKADIYSFAITLWQMVTKEVPYSGDHQYILYAVVAYNLRPALTS
SVFTDSLPGQRLEHIIQCCWTADTLVRPSSDLLLGDLNSLHANLADLNARS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgcccgttcccttggcccgttatttacctagagagttttctccgtccgtggac
ttgcggccctgcagcagccccctggagctccccgggaagaggggcaagctctttttagag
ggaactccctccccccgggctcggaggctgccccggaggctggcctggtgttccattgac
tgggatcagttatgctttctgcggaagctggggactggggggtttggctcggtctataag
ggcacataccgagggctcacggtcgcgatcaaacaagtgaagaagtgcaacaagaaccgg
ctagcttcccggcagagcttctgggccgagctcaatgtcgccaggctgtgccataaaaat
gtggtgcgagtcttggccgccagcacttgcactccccggggttacaacagcctagggacc
atcatcatggagtactgggggcacactaccctttacgacgtcatctacggggctagctcc
gcgcccgacaacgagtccagcgccgaggagcccttggacttgggaagatgcctccagtat
tccctggacgtggtcaacggcctgcttttcctccactctcaaggcatagtccacttggat
ctcaagccggccaacatcttgatcggggagcaagagatctgcaaaattggggactttggg
tgttcgcaaaagctagaggatctgctgggtctgagctcgcaccattgccacctgggcggt
acatacacacaccgcgccccagagctcctcaaaggagaggcggtgactgacaaagcagat
atttattcttttgccatcacgctctggcaaatggtcacaaaggaagtgccttattcaggc
gaccaccaatacatactctatgctgtggtggcttataacctccggccagcgctcacatcc
tctgtcttcactgactccttacctggccagagactggaacacattatccaatgttgctgg
accgctgacacattggtcagacccagctcagacctgctcctgggtgatcttaattccttg
cacgctaacttggcagacttgaatgctagaagttaa

DBGET integrated database retrieval system