KEGG   Monodelphis domestica (opossum): 100030053Help
Entry
100030053         CDS       T01031                                 

Gene name
RELA
Definition
v-rel avian reticuloendotheliosis viral oncogene homolog A
Orthology
K04735  
transcription factor p65
Organism
mdo  Monodelphis domestica (opossum)
Pathway
MAPK signaling pathway
Ras signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
Prolactin signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Cocaine addiction
Salmonella infection
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Pancreatic cancer
Prostate cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100030053 (RELA)
   04010 MAPK signaling pathway
    100030053 (RELA)
   04064 NF-kappa B signaling pathway
    100030053 (RELA)
   04668 TNF signaling pathway
    100030053 (RELA)
   04066 HIF-1 signaling pathway
    100030053 (RELA)
   04024 cAMP signaling pathway
    100030053 (RELA)
   04151 PI3K-Akt signaling pathway
    100030053 (RELA)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100030053 (RELA)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100030053 (RELA)
   04621 NOD-like receptor signaling pathway
    100030053 (RELA)
   04622 RIG-I-like receptor signaling pathway
    100030053 (RELA)
   04623 Cytosolic DNA-sensing pathway
    100030053 (RELA)
   04660 T cell receptor signaling pathway
    100030053 (RELA)
   04662 B cell receptor signaling pathway
    100030053 (RELA)
   04062 Chemokine signaling pathway
    100030053 (RELA)
  Endocrine system
   04920 Adipocytokine signaling pathway
    100030053 (RELA)
   04917 Prolactin signaling pathway
    100030053 (RELA)
  Nervous system
   04722 Neurotrophin signaling pathway
    100030053 (RELA)
  Development
   04380 Osteoclast differentiation
    100030053 (RELA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100030053 (RELA)
   05202 Transcriptional misregulation in cancers
    100030053 (RELA)
   05203 Viral carcinogenesis
    100030053 (RELA)
   05212 Pancreatic cancer
    100030053 (RELA)
   05221 Acute myeloid leukemia
    100030053 (RELA)
   05220 Chronic myeloid leukemia
    100030053 (RELA)
   05215 Prostate cancer
    100030053 (RELA)
   05222 Small cell lung cancer
    100030053 (RELA)
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    100030053 (RELA)
  Substance dependence
   05030 Cocaine addiction
    100030053 (RELA)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100030053 (RELA)
  Infectious diseases
   05132 Salmonella infection
    100030053 (RELA)
   05133 Pertussis
    100030053 (RELA)
   05134 Legionellosis
    100030053 (RELA)
   05152 Tuberculosis
    100030053 (RELA)
   05166 HTLV-I infection
    100030053 (RELA)
   05162 Measles
    100030053 (RELA)
   05164 Influenza A
    100030053 (RELA)
   05161 Hepatitis B
    100030053 (RELA)
   05160 Hepatitis C
    100030053 (RELA)
   05168 Herpes simplex infection
    100030053 (RELA)
   05169 Epstein-Barr virus infection
    100030053 (RELA)
   05146 Amoebiasis
    100030053 (RELA)
   05145 Toxoplasmosis
    100030053 (RELA)
   05140 Leishmaniasis
    100030053 (RELA)
   05142 Chagas disease (American trypanosomiasis)
    100030053 (RELA)
Transcription factors [BR:mdo03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    100030053 (RELA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 543 aa AA seqDB search
MEGLLPMIFASDSPPARGPFVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKIHGYLGPGTVRISLVTKEPPHRPHPHELVGKDCRDGFYEAELCPDHSIHSFQNLGIQC
VKKRDLEQAIAHRMQTNNNPFNVPLEEQRGDYDLNAVRLCFQVTIQDSAGRPLVLPPVLS
HPIYDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVCFSGPGWEARGSFS
QADVHRQVAIVFRTPPYAEAALQAPVRVHMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTLGTFKNIMKTSPFSGGNPDTWTSPRRIAVPSRTTGSTPKPPGILPGLSSSVPQPY
TFPPPLSTINLEELSPIVFSASQVQAPALASAPTPAPSLVPAPTSTAPAPAPALPPISQS
GEGTLSEALLGLQFDTDGDLAEILADPDSTYTNLAAIDNSEFQQLLNQGIPGTLEGPGPS
GEPMLMEYPESITRLMTGSQRPPEPTPAPPGASGLANGLLGADEVFPSMGDLDISAFLSQ
ISS
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggagggcctgttacccatgatctttgcctcagattcaccccctgcccggggccctttt
gtggagatcattgagcagcctaagcagcgggggatgcgcttccgctacaagtgtgaaggt
cgttccgctggcagcatccctggggagcgcagcacagacaccaccaagacccaccctacc
atcaagatccatggctacttaggaccagggactgtccgcatctccctggtgaccaaggag
cctcctcaccggcctcatcctcatgagttggtggggaaggactgtagggatggtttctat
gaagctgagctctgccctgaccacagcatccacagcttccagaacctggggattcagtgt
gtgaagaagcgagatctggagcaggccattgcccaccgaatgcagaccaacaacaatccc
ttcaatgttcctctggaagaacagcggggagactatgatctgaatgctgtccggctctgc
ttccaagtgaccatccaggactctgcaggaaggcccctcgtcctgccccctgtcctgtcc
catcccatctatgacaaccgggcccccaacaccgcggagctgaagatctgccgtgtgaac
cgtaactcggggagctgcctgggtggggacgagatcttcctcctgtgcgacaaggtgcag
aaagaggacatcgaggtgtgcttctcggggcccggatgggaggcgcgcgggtccttctcg
caggccgacgtgcacaggcaggtggccatcgtgttccgcacaccgccgtatgccgaggcc
gccctacaggccccggtgcgggtccacatgcagctgcggcggccttctgaccgggagctc
agcgagcccatggagttccagtatctgccagacacagacgatcgacacagaattgaagag
aaacgcaagaggacgttgggcacctttaagaacatcatgaagacgagccctttcagtggg
ggcaatcctgacacctggacgtcccccagacgcatcgccgtgccctcccgcaccacaggc
tctactcccaaacctccaggtatccttcctggcctgtcttcctcagtgccccagccctac
accttcccaccacccctcagtaccatcaacctggaggagctttctcccatagtcttttca
gctagccaggtgcaagccccagccctggcctctgcccctacgccggccccctccctggtc
ccagcccccacctcgactgcccctgcccctgcccctgccctgccccctatctcccagtct
ggggaggggacgctgtccgaggccctgctgggcctgcagtttgatacagatggagatctg
gccgagattctggctgaccccgacagcacctacaccaacctggcagccatcgacaattcg
gagttccaacagctgctgaaccaggggataccagggaccctcgaagggcctgggccctca
ggggagcccatgctgatggaataccccgagtccatcacccgccttatgacggggtctcag
cggccccccgagcccaccccagcgcctccgggggcctcggggcttgccaacggtcttcta
ggggcagatgaagtcttcccctccatgggggatttggacatatcagccttcctaagtcag
atcagctcttaa

DBGET integrated database retrieval system