KEGG   Monodelphis domestica (opossum): 100030068Help
Entry
100030068         CDS       T01031                                 

Gene name
USP47
Definition
ubiquitin specific peptidase 47
Orthology
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.1.2.15]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 1360 aa AA seqDB search
MFWRCRQSIFDEMKKKFSQIENAAEEPRVLCIIQDTTNSKTVNERITLNLPASTPLRKLF
EDVANKVGYVNGTFDLVWGNGISATDMPLDHTSDKSLLDTNFEPGKKNFLHLTDKDGEQP
QILSEDSSAVDDSVQDRFIGPLPREGSVGSTGDYVSQSYSYSSILNKSETGYVGLVNQAM
TCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTD
VTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINELYQGKLKDYVRCLECG
YEGWRIDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARK
GLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSTFIDIEDEKSPQTESCT
DSGAENEGSCHSDQMSNDFSNDDGVDEGICLESSSGTEKITKPGLEKNSLLYELFSVMVH
SGSAAGGHYYACIKSFSDEQWYSFNDQHVSRITQEDIKKTHGGSSGSRGYYSSAFASSTN
AYMLIYRLKDPSRNAKFLEVNDYPEHIKSLVQKEKELEEQEKRQREIERNTCKIKLFCMH
PVKQVMMENKLEVHKDKTLKEAVEIAYKMMDLEEVIPLDCCRLVKYDEFHDYLERSYEGE
EDTPMGLLLGGVKSTYMFDLLLETRKPDQVFQSYKPGEVMVKVHVVDIKTESVAPPVSVR
AYLNQTVTEFKQLISKAIHLPAETMRIVLERCYNDLRLLNVSSKTLKAEGFFRSNKVFVE
SSESLDRQMAFTDSHLWKLLDRHANTIRLFVLLPEQSPGSHSKRTAYQKAGGDSGNVDDA
CERVKGPLGSLKSVEAILEESTEKLKSLSLQQQQDGDNGDSSKSTETSDFENIESPLNER
DSSGSVDNRELEQQIQTSDPENFQSEERSDSDVNNDRSTSSVDSDILSSSHSSDTLCNAD
SAPVPLANGLDSHSITSSRRSKANEGKKETWDTAEEDSGTDSEYDESGKSRGETQYMYFK
AESYAADEGSGEGHKWLMVHVDKRITLAAFKQHLEPFVGVLSSHFKVFRVYASNQEFESV
RLNETLSSFSDDNKITIRLGRALKKGEYRVKVYQLLVNEQEPCRFLLDAVFAKGMTVRQS
KEELLPQLREQCGLELSIDRFRLRKKTWKNPGTVFLDYHVYEEDINISSNWEVFLEVLDG
VEKMKSMSQLAVLSRRWRPTDMRLDPFQEVVLESSSVDELREKLCEISGIPLEDIEFAKG
RGTFPCDISVLEIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRNEL
MKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD
NT seq 4083 nt NT seq  +upstreamnt  +downstreamnt
atgttttggagatgcagacaaagtatctttgatgaaatgaagaagaaattttcacagata
gaaaatgctgctgaagaacctagagttttatgtattatacaagatactactaattcaaag
acagtcaatgaacgaatcactttaaatttaccagcttctactccactgaggaaattattt
gaagatgtggccaacaaagtgggctatgtaaatggaacctttgatttggtgtggggaaat
ggaatcagtgctactgacatgcctttggatcacaccagtgacaaatctcttcttgatact
aactttgaacctgggaagaaaaactttcttcatttgacagataaagatggtgaacagcct
cagatactatcggaggactccagtgcagtagatgacagtgtgcaagataggtttattggt
cccctcccaagagaaggttctgtaggctccactggtgattatgtcagtcaaagctactca
tattcttctatattgaataaatcagaaaccggatatgtgggattagtaaatcaagcaatg
acttgctatttgaacagccttctgcaaacacttttcatgactcctgaattcaggaatgca
ttgtataagtgggaatttgaggaatctgaagaagatcctgtgacaagcattccataccag
cttcagagactctttgttttattacaaaccagcaaaaagcgagcaattgaaacaactgat
gttacgaggagctttggatgggatagtagtgaagcttggcagcaacatgatgtacaagaa
ctttgtagagtcatgtttgatgcattggaacagaagtggaagcaaactgagcaggctgat
cttataaatgaactgtatcaagggaagctgaaggactacgtgaggtgtctggaatgtggt
tatgagggctggagaatcgacacatatcttgacattccattggtcatccgaccttatggc
tccagccaggcatttgctagtgtggaagaagcattacatgcatttatacagccagagatc
cttgatggtcccaatcagtatttttgtgagcggtgtaagaagaagtgtgatgcacggaag
ggccttcgttttttgcattttccatatctgctgaccctgcagttgaaaaggtttgatttt
gattacaccaccatgcacaggattaaattaaatgaccggatgactttcccagaagagcta
gatatgagtacatttattgacattgaagatgagaagtctccccagactgagagttgtacc
gacagtggagcagaaaatgaaggcagttgtcacagtgatcagatgagcaacgatttctca
aatgatgatggggtcgatgaaggaatctgccttgaaagtagtagtggaactgaaaagatt
acaaaacctggtcttgaaaagaattcattgctatacgaactcttttctgttatggttcat
tcgggaagtgcagctggtggtcattattatgcgtgcataaaatcattcagtgatgagcag
tggtacagcttcaatgatcagcatgttagtcggataacccaagaggacattaagaaaact
catggtggatcttcaggaagtcgaggatattattctagtgcctttgcgagctccacaaat
gcatatatgcttatatatagattgaaggatccttcgagaaatgcaaaatttttagaagtg
aatgactacccggagcacattaagagtttggtgcaaaaagagaaagaattggaagagcaa
gaaaagaggcagcgtgaaattgaaagaaatacctgcaagataaaattgttctgcatgcat
cctgtgaaacaagtcatgatggaaaataaattggaggttcataaagataagactctaaaa
gaagcagtagaaatagcttataagatgatggatttggaagaggtcattcccctggattgc
tgtcgtcttgttaagtatgacgagtttcatgattatctagagcgatcatatgaaggagaa
gaggatactccaatggggcttctacttggtggagtcaagtcaacatacatgtttgatcta
ctcttggaaaccagaaaacctgatcaggttttccagtcttataaacctggtgaagtgatg
gtgaaagttcatgtggttgatataaagacagaatctgttgctcctccagttagcgtacga
gcttatttaaatcaaacagtcactgaatttaagcagcttatttcaaaggctatacatttg
cctgctgaaacaatgagaatagttctggaacgctgctacaatgacttgcgtcttcttaat
gtgtccagtaaaacactgaaggctgaaggcttctttagaagtaacaaggtatttgtcgaa
agttctgaatctttggatcgacagatggcctttacagactctcatttgtggaaactgctg
gatcggcatgcaaatacaatcagactgtttgttttattacctgaacaatctccaggatct
cattctaaaaggacagcataccagaaagctggtggagattctggcaatgtagatgatgca
tgtgaacgagttaaaggacctctaggtagcctaaaatctgtagaggctatcttagaagaa
agtactgaaaagcttaaaagcttgtctctacaacagcaacaggatggagataatggagac
agtagcaagagtactgagacaagtgattttgaaaacattgaatcacctctcaatgagaga
gattcttcaggatcagttgataacagagaacttgaacagcaaattcagacttctgatcca
gaaaatttccagtctgaagagcggtcagactctgatgtgaacaatgacaggagtacaagt
tcagtggacagtgatattcttagttccagtcacagcagtgacactttgtgcaatgcagac
agtgccccagtccctttggctaatggacttgactctcatagtatcacaagtagtagaaga
tctaaggcaaatgaaggaaagaaagagacctgggatacagctgaagaagactctggaact
gatagtgaatatgatgaaagtggcaagagcaggggagaaacacagtatatgtatttcaaa
gcagaatcctacgctgcagatgaaggttctggagaaggacataaatggttgatggtgcat
gttgataaaagaattacactggctgccttcaaacaacatttggaaccctttgttggagtt
ctgtcttctcacttcaaagtttttcgagtctatgccagcaatcaagagtttgagagtgtc
cgactgaatgaaacactttcatcattttcagatgacaacaagattacaattagattgggg
agagcacttaagaagggagagtacagagtcaaagtgtaccagcttttagtaaatgagcaa
gagccctgtaggtttctccttgatgctgtttttgctaaaggcatgactgtccgacagtct
aaagaagagctccttccccagctcagggagcagtgtgggctagaactcagcattgacagg
tttcgtctaaggaaaaaaacatggaagaatcctggcacagtctttctagattatcatgtc
tatgaagaggatattaatatttccagcaactgggaggttttccttgaagttcttgatgga
gtggagaagatgaaatccatgtcacaactggctgtgctgtctaggcggtggaggccaaca
gacatgagactcgaccccttccaagaggtggtgttagaaagcagcagtgttgatgaactg
agagagaagctttgtgaaatcagtgggatacctttggaagatattgaatttgcaaagggc
agaggaacatttccctgtgacatatctgtcctagaaattcaccaggatttggattggaac
cctaaagtttctacactgaatgtgtggcccctttatatctgtgatgatggcgcagtgata
ttttatagggataaaactgaagaattaatggaattaacagatgagcagagaaatgaactg
atgaaaaaggaaagcagccggctccaaaaaactggacatcgtgtaacctactctcctcgt
aaagaaaaagcactaaaaatttatctggacggagcaccaaataaagatttgactcaagac
tga

DBGET integrated database retrieval system