KEGG   Monodelphis domestica (opossum): 100030102Help
Entry
100030102         CDS       T01031                                 

Gene name
MYST3
Definition
K(lysine) acetyltransferase 6A
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1951 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDGKQNVDWNKLIKRAVEGLAESSGSTLKN
IERFLKGQKDVSALFGGSAASVFHQQLRLAVKRAVGHGRLLKDGPLYRLNTKVANVDGKE
SCESLSCLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPS
CLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PKGMWICQICRPRKKGRKLLHKKAAQIKRRYANPIGRPKNRLKKQNTVSKGPFSKVRTGP
GRGRKRKITISSQSASSSEEGYLEQMDLDFCRDGSTPLKFNKKTKGLIDGLTKFFTPSPD
GRKARGEVVDYSEQYRIRKKGNRKSSTSEWPTDNQDGWDGKQENEERLFGSQEVMTEKDM
ELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRYVVDGNVST
IYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCI
MILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQN
DKQISIKKLSKLTGICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQVNLRPV
DVDPECLRWTPVIVSNSVVSEEEEDDAEEGENEEQQCQEKELDSSMAKPVSWEKKEDSYS
IENEKKPDIIVPANSTRLNKEVLPLDSLPANSQPSRRGRWGRKNKKVREPFSEKESKLPL
EETPSVPRGRYGECEEKSEASQEQFTESEEHSAALEGRFGKDEKPEVPKRRINESVEMWS
SRGPLKKSPEPLKCRIPDGSDRLPHRYNDGDRAILRGFSESSEEEEEPESPRSNSPPVLT
KPTLKRKKPILHRRRRVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFE
IDEEEEEEDENELFPRGYFHRLPSQEVLRHRPSSKRKSKDEEEESDDADGTPILKPVSML
RKCDVKDSALEPDTSTPLKKKKGWPKGKSRKPIHWKKRPGRKPGFKLNREMITVSTQECR
ADSMVPLPKPGRKPKIQEKEEAAKPKEDLPLAEERKENDMLGDIEEGGEGEEEDTTSSEV
RASSPVDSRGSPVTESKEPEIEEEEVEEKPRVLEEEQRQSEEEQPELEEQEHEEEDEVTL
GTNQNEDHDADDEDDGHLESTKKKESEEQTIREGVKEEPGGQESFLEANTQNNREEIKSK
NETEPDSEEEQTSHETSVVSEHMPGSEDDHEEETNTKEELIELKEEEEIPHSELDLETVQ
AVQSLTQEESNEHDGTYQDCEETLAACQTLQSYTQADEDPQISMVEDCHASEHNSPISSV
QSHPSQSVRSVSSPNVPALESGYTQISPEQGSLSAPSMQNMETSPMMDVPSVSDHSQQVV
DSGFSDLGSIESTTENYENPSSYDSTMGGSICGNNSSQSSCSYGGLSSSSSLTQNSCVVT
QQMANMGSSCSMMQQNSVQPATNCNIKSPQSCVVERPPSNQQQQPPPPQQQQQQQQQQPA
PPPPQQQPQPQPQPQPPQPPPPPQQQPPLSQCSMNNSFTPAPMIMEIPESGSTGNISIYE
RIPGDFGASSYSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQ
LAPSHPLAGAPQAQATMTPPPNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKG
HISIRSKSAPLPSAAAHQQQLYGRSPPAVAMQAGPRALAVQRGMNMGVNLMPTTPYNVNS
MNMNTLNAMNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPH
GNMMYTGPSHHSYMNTAGVPKQSLNGPYMRR
NT seq 5856 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgctaacccgctgtatacggagtggattttggaggcgatcaaaaaagta
aagaagcaaaaacagcgtccttcagaagagaggatatgcaatgcggtgtcttcatcccat
ggcttggaccggaaaactgttttagaacaattggagttgagtgttaaagatggaacgatt
ttaaaagtctcaaataaaggcctcaattcctataaggatcctgataatcctgggcgaata
gcacttcctaaacctcggaaccatggaaagttggatggcaaacaaaatgtggattggaat
aaacttatcaaacgggcagttgaaggcttggcagagtccagcggttcaaccttgaagaac
attgaacgttttttgaagggtcagaaagatgtgtctgcattgtttgggggcagtgccgcc
tctgtctttcaccagcagttacgattggctgtcaaacgtgccgttggccacggcagacta
cttaaagatggacctctttatcggctcaacactaaagtggccaatgtggatgggaaagag
agttgtgagtctctttcctgtctacctcctgtgtctctccttcctcatgaaaaggataag
ccagttgctgaaccaattccaatctgtagtttctgtcttggtacaaaagaacaaaaccga
gagaagaaaccagaggagctcatttcttgtgctgactgtggcaacagtggtcatccatcc
tgtttaaagttctctccagagttaacagttcgagtgaaggccttacggtggcagtgcatt
gagtgtaaaacgtgtagctcttgtcgagaccagggaaaaaatgcagataatatgctcttc
tgtgattcatgtgaccggggctttcacatggaatgctgtgatccaccgctcaccaggatg
ccgaaaggcatgtggatttgtcagatttgtcgacctcggaaaaaaggaagaaaacttcta
cataaaaaagcagcacagataaaacggcgctatgccaatccaataggacgccccaaaaac
aggttaaagaaacaaaacacagtatcaaaaggccctttcagcaaagttcgaactggacct
ggtcggggtcggaaacgtaaaatcacaatctcgagccaatcagcatcttcatcagaagaa
ggatatttggagcaaatggacttagacttctgcagagatggtagtacacccctgaaattc
aataagaaaaccaaagggctcattgatggccttaccaaattcttcaccccctcccctgac
gggcggaaagctcgtggggaagtggtggactactctgagcaatataggatcaggaaaaag
ggcaacaggaaatcaagcacttcagagtggcccacagacaatcaggatggctgggatggg
aaacaggaaaatgaagagcgactttttggaagccaggaagtcatgactgaaaaagatatg
gaattatttcgagatatccaggagcaagcactgcagaaagttggagtgactggtccccct
gatccacaagtccgctgtccctctgtcattgagtttggaaaatatgaaattcatacctgg
tactcctccccatatccacaagaatactcaaggtatgttgttgatgggaatgtcagtaca
atttactgtcaaaatttgtgcctattggcaaagctttttcttgaccacaagacactctat
tatgatgtggaaccatttcttttctatgtattgacacagaatgatgtcaagggctgccat
cttgttggctacttttctaaggaaaagcactgccaacagaagtataacgtttcctgtata
atgattcttcctcaataccagcgcaagggctatggcaggttcctcattgacttcagttat
ttgttgtcaaagcgtgaaggccaagctgggtctccagagaaaccattatctgatctaggt
cgtctttcctacatggcttattggaaaagtgtaatattggagtgcctttatcaccaaaat
gacaagcaaatcagcattaaaaaattaagcaaattgactggaatctgtcctcaagacatt
acttccacactccatcacctacgaatgctggacttccgtagtgaccaatttgtgattatc
cgccgggaaaaactgatccaggatcatatggcaaagcttcaagtgaatttgagacctgta
gatgtagatcctgaatgcttgcgttggactcctgtcattgtctccaattctgtagtctca
gaagaagaggaagatgatgcagaggaaggtgaaaatgaagagcaacaatgccaggaaaag
gaactggattccagcatggcaaagccagtgtcttgggagaaaaaagaagattcttattca
atagagaatgaaaagaaaccagatattattgtaccagccaattctacacgactaaacaag
gaagttctccccctggatagtcttccagcaaatagtcagccatctcggagaggtcgatgg
ggacgaaagaacaaaaaagtccgagagccttttagtgagaaagagtctaaactgcccttg
gaagaaacaccatcagttcctcgggggcgatatggtgaatgtgaggaaaaatctgaagcc
tcccaggagcagtttactgagagtgaagagcattcggcagctttagaagggcggtttggc
aaagatgaaaagccagaagttcctaaaaggcgaataaatgaaagtgtggagatgtggtcc
tcccgaggaccactgaagaaaagcccagaacctctcaagtgcagaataccagatggaagt
gataggttgcctcaccgatataatgatggagacagagccattttgaggggctttagtgag
agtagtgaagaggaagaagaacctgagagtcctcggtcaaattcaccacctgtgcttact
aaacccacattaaaacgaaagaaaccaattcttcatcggaggaggagagtccgaaagcga
aaacaccacaatagcagtgtggtcacagaaactatctctgagaccacagaagttttagat
gaaccttttgaagattctgactctgagaggccaatgccaagattagagcctacatttgaa
attgatgaagaggaggaagaagaggatgaaaacgaactctttcccagaggatactttcat
cgtttgccctcacaagaggttcttcggcatcgaccttcttctaagaggaaatctaaagat
gaagaggaagaatcagatgatgctgatggcacccctatcctgaagccagtatccatgttg
agaaaatgtgatgtgaaggattccgcacttgagccagatacttctacacctttgaaaaag
aaaaaaggatggcccaaaggcaaaagtcgtaaaccaatccactggaagaaaaggcctggc
cgaaaaccagggttcaagctgaaccgagaaatgataacagtatctactcaagaatgtaga
gctgattccatggtaccccttcctaagcctggacgtaagcccaaaattcaagagaaagaa
gaggctgctaaaccaaaagaagacttgccccttgctgaagaaaggaaggagaatgatatg
cttggagacatagaagagggaggagagggagaagaagaagatacaaccagcagtgaagta
agagcatcttccccagtggacagtcgtggtagcccagtgacagaatctaaagaacctgag
atagaagaagaagaagttgaggagaaaccccgggttttagaagaagaacaaaggcaatca
gaggaagagcagccagagttggaagagcaggaacatgaagaagaggatgaggtgaccctt
ggaacaaaccagaatgaggaccatgatgcagatgatgaagatgatggtcatctagaatcc
acaaagaaaaaggaatctgaggaacagacaattagagaaggcgtcaaggaggaacctggg
ggtcaggaatcttttttagaagcaaatacacagaacaatagagaggaaataaagagcaaa
aatgaaacagaaccagattctgaggaagaacaaacttcccacgagacatcagttgtttca
gaacatatgccagggtctgaggatgatcatgaagaagaaacaaatactaaggaggaatta
attgaattaaaagaagaagaagagattcctcatagtgaattggatttggaaacagtgcaa
gcggtacagtcactgacccaggaagaaagcaatgaacacgatgggacataccaggactgt
gaagaaacacttgcggcttgtcagactttgcaaagttatacccaagctgatgaagaccct
cagatatcaatggttgaagactgccatgcttcggaacacaacagcccaatatcttctgtt
cagtctcatcctagccaatcggtccgttcagtcagcagtcccaatgtgcctgctcttgag
agtggttatacccagatcagccctgagcaaggatccctgtccgcaccctctatgcagaac
atggagaccagccccatgatggatgtgccttcggtgtcagaccactctcagcaggtggtg
gacagtggcttcagtgacctgggtagcattgagagcaccacagaaaattatgagaaccct
agcagctatgattccacaatgggtggcagcatttgtggaaataactcttctcagagcagt
tgctcttatggagggttgtcctcctccagtagcctcactcagaacagttgtgttgtcact
cagcaaatggccaatatgggcagtagctgtagcatgatgcagcagaacagtgtgcaacct
gccaccaactgtaacatcaagtcacctcagagttgtgtggtggaaaggccaccaagtaac
cagcagcagcagccaccgccaccccagcagcagcagcaacagcagcagcagcagccagca
ccgccacccccccagcagcagcctcagccccagccccagccccagcctcctcagccccct
ccacccccccagcagcagcctccgctgtcacagtgtagtatgaataacagcttcactcca
gccccaatgatcatggaaataccggaatccggaagcactgggaacataagtatctatgaa
aggattccaggggattttggtgccagcagctactcccaaccatcagccaccttcagttta
gccaagttgcagcagctgactaacaccattatggacccacatgccatgccttatagccat
tctcctgctgtgacttcctatgcaaccagtgtttctttatccaacacaggactggctcag
ctagctccatcccatccattagctggggcccctcaagcacaagccaccatgacaccaccc
ccaaacctggcatctactaccatgaacctcacatcacctctgcttcagtgcaacatgtct
gccaccaacattggcattccccacactcagaggttgcaagggcaaatgccagtcaagggg
catatttccatccgttctaaatcagcaccactgccctcggcagctgctcaccagcagcag
ctttatggtcgcagcccgccagcagttgccatgcaggctggcccacgtgcattagctgtt
cagcgtggcatgaacatgggggttaacttaatgccaacgaccccctataatgtcaattcc
atgaatatgaacactttgaatgccatgaacagttaccgaatgacacagcccatgatgaac
agcagttaccatagtaaccctgcctacatgaaccagacagcacagtatcctatgcagatg
cagatgggaatgatggggagccaggcctatacccagcagcctatgcagccaaaccctcat
gggaacatgatgtacactggcccctcccatcacagctacatgaatactgctggcgtgccc
aagcagtctcttaatggaccttacatgagaagatga

DBGET integrated database retrieval system