KEGG   Monodelphis domestica (opossum): 100030115Help
Entry
100030115         CDS       T01031                                 

Definition
myosin regulatory light chain 2, atrial isoform-like
Orthology
K12754  
myosin regulatory light chain 7
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mdo04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:mdo04510]
Cellular Processes; Cell communication; Tight junction [PATH:mdo04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:mdo04670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 227 aa AA seqDB search
MKAGVAPACLGICQEHCSLEAAPQFLQPLIQNRTAPFHLKEAELLLTAGAMEDASRKAGT
RGKVAAAKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIISKSDLKETYSQLGRAN
VPEEELDEMLQEGKGPINFTVFLTLFGEKLNGTDPEESILSAFRMFDPSGSGVVNKEEFK
QLLLSQADKFSPAEVEQMFSLTPMDLSGNIDYKSLCYIITHGDEKEE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaggtgttgctcctgcctgcctaggcatctgccaggagcactgctcactggaa
gctgctccccaatttcttcagcccttgatccagaacagaactgctccatttcacctgaag
gaggcagaacttttgctgacagcaggtgccatggaagatgccagccggaaggcaggaact
cgggggaaggtggcggctgccaagcaagcccaacggggatcttccaatgtcttctccatg
tttgaacaggcacagatccaggagtttaaggaggcattcagctgcattgatcaaaatcga
gatggcatcatcagcaaatcagatctgaaggagacctactcccaactaggaagagcaaat
gtgcctgaggaagagttggatgagatgctacaggaaggcaaaggtccaatcaacttcaca
gtctttctcacactctttggggagaaactcaatggaactgaccctgaagaatccatcctc
agtgctttccgcatgttcgatcccagtggcagtggggttgtcaacaaagaagagtttaag
cagctccttctctcccaggcagacaagttttctccagcagaggtggaacaaatgttttca
ttgacacctatggacctatcaggaaacatcgactataaatccctgtgctacatcatcacc
catggggatgagaaggaggagtga

DBGET integrated database retrieval system