KEGG   Monodelphis domestica (opossum): 100030115Help
Entry
100030115         CDS       T01031                                 

Gene name
MYL7
Definition
myosin, light chain 7, regulatory
Orthology
K12754  
myosin regulatory light chain 7
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100030115 (MYL7)
  Cellular commiunity
   04510 Focal adhesion
    100030115 (MYL7)
   04530 Tight junction
    100030115 (MYL7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100030115 (MYL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 175 aa AA seqDB search
MASRKAGTRGKVAAAKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIISKSDLKET
YSQLGRANVPEEELDEMLQEGKGPINFTVFLTLFGEKLNGTDPEESILSAFRMFDPSGSG
VVNKEEFKQLLLSQADKFSPAEVEQMFSLTPMDLSGNIDYKSLCYIITHGDEKEE
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggccagccggaaggcaggaactcgggggaaggtggcggctgccaagcaagcccaacgg
ggatcttccaatgtcttctccatgtttgaacaggcacagatccaggagtttaaggaggca
ttcagctgcattgatcaaaatcgagatggcatcatcagcaaatcagatctgaaggagacc
tactcccaactaggaagagcaaatgtgcctgaggaagagttggatgagatgctacaggaa
ggcaaaggtccaatcaacttcacagtctttctcacactctttggggagaaactcaatgga
actgaccctgaagaatccatcctcagtgctttccgcatgttcgatcccagtggcagtggg
gttgtcaacaaagaagagtttaagcagctccttctctcccaggcagacaagttttctcca
gcagaggtggaacaaatgttttcattgacacctatggacctatcaggaaacatcgactat
aaatccctgtgctacatcatcacccatggggatgagaaggaggagtga

DBGET integrated database retrieval system